KEGG   Brucella suis 1330: BR0648Help
Entry
BR0648            CDS       T00096                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bms  Brucella suis 1330
Pathway
bms03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BR0648
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bms03400]
    BR0648
Enzymes [BR:bms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BR0648
DNA repair and recombination proteins [BR:bms03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BR0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF4918
Motif
Other DBs
NCBI-ProteinID: AAN29577
LinkDB All DBs
Position
I:complement(639751..640422)
Genome map
AA seq 223 aa AA seqDB search
MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDVRLLIVGLAPGLRGAN
RTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACIVNAVRCVPPENKPVGS
EINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSRHPFGHGKATDIGPLRIF
SSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLSV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgaaccttcgccaaattgctcaatctgcccgcggctccatgcgttcttacag
gaatggcgacaaaaggagcctgcgtggcataacgcgcccgtcccccctttccttcccggg
agcgatgaagacgttcggcttctgatcgtagggcttgcccccggccttcgcggagccaac
cgcacgggacggccctttaccggcgattatgccggggaacttctttacagtacgctttgc
gaattcggcttcgcgacgggaaaattcgaggcgcgcccggatgacagcctgcggcttctc
gatgcctgcatcgtcaatgcggttcgctgcgtgccgccggaaaacaagcctgtcggcagc
gaaatcaacaattgccggcaattcctgacaccgatgctgacgcgctttcccaatctcgat
gcagtggtcacactggggaccatcgcccatcaatcaacagtgcgcgccttaggcgttccg
gtttcgcgccacccgttcggccatggcaaggccaccgatatcgggccattgcggattttt
tccagctatcattgctcgcgctacaacacgaatacgggcgtgctgaccgatgcgatgttc
cgcgatgttttcaaaaatgtacgcgcttatctaagcgagaaagcagccggaagcgcacgt
ctgtctgtctga

DBGET integrated database retrieval system