KEGG   Brucella suis 1330: BR0885Help
Entry
BR0885            CDS       T00096                                 

Gene name
serS
Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
bms  Brucella suis 1330
Pathway
bms00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bms00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BR0885 (serS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bms01007]
    BR0885 (serS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bms03016]
    BR0885 (serS)
Enzymes [BR:bms01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     BR0885 (serS)
Amino acid related enzymes [BR:bms01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BR0885 (serS)
Transfer RNA biogenesis [BR:bms03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BR0885 (serS)
 Prokaryotic type
    BR0885 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: AAN29813
UniProt: Q8G139
LinkDB All DBs
Position
I:857683..858966
Genome map
AA seq 427 aa AA seqDB search
MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK
AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES
DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ
FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV
AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE
RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ
GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYIGGL
TRIEKAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcaaatggattcgcgaaaacccggaaaccctcgacaaggcgctcgcaaag
cgtggggctgctccgctttcgtccgaactgattgcgctggatgaaaagcgccgcgagcat
gtcggcaaggtgcaggcagcgcaggagcgccgcaatgccgcctcgaaggaaatcggcaag
gccatggccgcaaaggacatgggcacggctgaaaagctgaaggccgaagtgggcgaactg
aaagattttctcgcccatgcggaagaagacgagcgccgcctcagcaaggaactgagcgac
gcattgtccaccattcccaatattccgcttgatgatgtgccgctcggcaaggatgaaagc
gacaatgttgagctgcgccgcattggcaacccgcacaatttctccttccagccgaaagag
cattttgagcttggcgaggcgcttggatacatggatttcgagcgcgcggccaagcttgcc
ggtgcgcgctttacggtgctgaaaggcccgctcgcccgtcttgagcgcgcgcttggccag
ttcatgctcgatcttcacacgacagaacacggttataccgaagtcatgccgccgctgatg
gtgcgcgacgaagcggtctatggcacggggcaattgccgaagttttcagaagatcttttc
cgcacgacggatggccgctggctgatcccgacggcggaggtgccgctcaccaatctggtt
gccgaagaaattgtcgatatgaaggggctgccgctgcgcttcacggcgctgaccccatgt
tttcgctcggaagcggggtcggccgggcgcgatacgcgcggcatgttgcgccagcatcag
ttcctgaaagtggagatggtatcgatcaccgatgcggaaagctccgttgccgagcatgag
cgcatgacggcttgcgcggaagaagtgctgaagcggctgggcctgccgttccgtaccgtt
gtgctttgcacgggcgacatgggctttggcgcacagcggacctatgatatcgaggtctgg
ttgccggggcagaacacctatcgcgaaatttcaagctgttcgacctgcggtgatttccag
ggccgccgcatgaatgcccgctatcgcccggaaggcgagaaatccacgcgcttcgtgcac
accctcaacgggtcgggcgttgctgtcgggcgcgcgctgattgcggttatggaaaattac
cagcaggaagacggcagcattcatattcctgaagcattacagccatatataggcggcctc
acgcggatcgaaaaagccgcttga

DBGET integrated database retrieval system