KEGG   Brucella suis 1330: BR1901Help
Entry
BR1901            CDS       T00096                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bms  Brucella suis 1330
Pathway
bms00020  Citrate cycle (TCA cycle)
bms00190  Oxidative phosphorylation
bms00650  Butanoate metabolism
bms01100  Metabolic pathways
bms01110  Biosynthesis of secondary metabolites
bms01120  Microbial metabolism in diverse environments
bms01130  Biosynthesis of antibiotics
bms01200  Carbon metabolism
Module
bms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bms_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BR1901 (sdhB)
   00650 Butanoate metabolism
    BR1901 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BR1901 (sdhB)
Enzymes [BR:bms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BR1901 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BR1901 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AAN30794
LinkDB All DBs
Position
I:complement(1836001..1836780)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQMEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgacatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagatggaatggctgcaaagccatgaggac
cgccagaagctcgatggtctttatgagtgcattctgtgcgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgaccgttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgaacgccgcgtgtaa

DBGET integrated database retrieval system