KEGG   Brucella suis ATCC 23445: BSUIS_B0915Help
Entry
BSUIS_B0915       CDS       T00638                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00473  D-Alanine metabolism
bmt01100  Metabolic pathways
bmt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSUIS_B0915 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSUIS_B0915 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmt01011]
    BSUIS_B0915 (alr)
Enzymes [BR:bmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSUIS_B0915 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmt01011]
 Precursor biosynthesis
  Racemase
   BSUIS_B0915 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABY39871
UniProt: A9WVT5
LinkDB All DBs
Position
II:895981..897171
Genome map
AA seq 396 aa AA seqDB search
MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPA
FYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTQAACAREGILPVLNSLEQVE
NWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDE
PGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHD
FSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYA
DGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLED
VARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcatattgaccatt
gatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgccccaacccgt
acggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtcgcaccggct
ttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagcagtggcgctg
aagccctttttgaaacctgacgcaacactttatgtcctgaacggccttcagcccggaacg
caagcagcctgtgcccgcgaaggtatcctgcctgttctcaattcgctggaacaggttgaa
aactgggcagcactcgccacccggctgggcaaaaaactgcccgctctgctccagttcgat
accggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttcttgagaacgtc
acgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaacggcgacgag
ccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctcgctcgcctg
ccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaagacctattat
ttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagaggcagcatgac
ttttcggataaggtggcgcacgagaataagaaacccaagcattcgatccttcccgtcctc
accctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgacagttggctat
ggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtcggctatgct
gacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgatacgcgcctg
cccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctcattgccggag
ggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgcctcgaagac
gtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggcaaccgttat
gcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system