KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0234Help
Entry
Bmul_0234         CDS       T00624                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bmu03012]
    Bmul_0234
   03029 Mitochondrial biogenesis [BR:bmu03029]
    Bmul_0234
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmu04147]
    Bmul_0234
Translation factors [BR:bmu03012]
 Eukaryotic Type
  Elongation factors
   Bmul_0234
 Prokaryotic Type
   Bmul_0234
Mitochondrial biogenesis [BR:bmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bmul_0234
Exosome [BR:bmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bmul_0234
  Exosomal proteins of breast cancer cells
   Bmul_0234
  Exosomal proteins of colorectal cancer cells
   Bmul_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABX13929
UniProt: A0A0H3KI80
LinkDB All DBs
Position
1:267957..269147
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGETAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaaattcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggttctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcacgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcgcacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcgatcctggtgtgctcggctgcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcaaagctggcgctggaa
ggcgacaagggcgagctgggcgaaacggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcggtcgacggtacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcgtgatcaag
gtcggtgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggatcaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggccgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgattgcgccgatcgcgatggaagaaggtctgcgcttcgctatccgt
gaaggcggccgtaccgtcggtgctggcgtcgtcgcaaagatcatcgagtaa

DBGET integrated database retrieval system