KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1049Help
Entry
Bmul_1049         CDS       T00624                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Bmul_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABX14740
UniProt: A0A0H3KQ15
LinkDB All DBs
Position
1:complement(1144687..1145379)
Genome map
AA seq 230 aa AA seqDB search
MIDVYSWATPNGHKVHIMLEETGLAYRAHPIDIGAGDQFNAEFLKISPNNKIPAIVDDEG
PGGQPISLFESGAILIYLAEKTGQFLPTDPAARYATLEWLMFQMGGVGPMLGQTHHFRIY
APEKIEYAINRYTNEAKRLYNVMDKRLGESEYLAGDAYTIADIATFPWTRSWQNQGIELD
AFPNVKRWHEAIAARPAVQRGVEVLASLRKALQDDKAREVLFGATQYAKR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtctacagctgggcgaccccgaacggtcacaaggtgcacatcatgctcgag
gaaaccggcctcgcgtatcgcgcgcatccgatcgatatcggcgcgggcgaccagttcaac
gccgagttcctgaagatcagtccgaacaacaagatccccgcgatcgtcgacgacgaaggc
ccgggcgggcagccgatctcgctgttcgaatcgggcgcgatcctgatctatctcgcggag
aaaaccggccaattcctgccgaccgatccggctgcgcgctatgcgacgctcgaatggctg
atgttccagatgggcggcgtcggcccgatgctcggccagacgcatcacttccgcatctat
gcgccggaaaagatcgagtacgcgatcaaccgctacacgaacgaggcgaagcgactgtac
aacgtgatggacaagcgcctcggcgaatccgagtatctggccggcgacgcgtacacgatc
gcggacatcgcgacgttcccgtggacgcgttcgtggcagaaccagggcatcgagctcgac
gcattcccgaacgtcaagcgctggcacgaagcgatcgccgcacgccctgccgtgcagcgc
ggcgtcgaggtgctcgcgtcgctgcgcaaggcgctgcaggacgacaaggcgcgcgaggtg
ctgttcggcgcgacgcagtacgcgaagcgctga

DBGET integrated database retrieval system