KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1051Help
Entry
Bmul_1051         CDS       T00624                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bmul_1051
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_1051
Enzymes [BR:bmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bmul_1051
Transporters [BR:bmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bmul_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ABX14742
UniProt: A0A0H3KKX1
LinkDB All DBs
Position
1:1146508..1147164
Genome map
AA seq 218 aa AA seqDB search
MLQLCGIPLSNYYNKVKFVLLEHDIPFEECACSLPITDPARLADSPLGKIPFLKTEEGAL
FESQAIIEYLAARYPEKPIFPSGAFAAAKVRELVQTLELYIEWTTREVYAEAFFGGKVSD
GTKAHVEKRLPRAIDAFKRMTQFSPYVLGDSFGLADIAASIHLPIVAMATKTIFGRDFVL
DAGIDWKAHAKKVGERPAAQRVAADRKAYMEAASAARA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctacagctgtgcggtattccgttgtcgaactactacaacaaggtgaagttcgtgctg
ctggagcacgacattccgttcgaggaatgcgcatgcagtctgccgatcacggatccggcg
cggctcgccgattcgccgctcggcaagattccgtttctgaaaaccgaagaaggcgcgctg
ttcgagtcgcaggcgatcatcgagtatcttgcggcgcgctatcccgagaagccgattttt
ccgtcgggcgcattcgcggctgcgaaggtgcgcgaactcgtccagacgctcgagctgtac
atcgagtggaccacgcgcgaggtctatgcggaagcgttcttcggcggcaaggtcagcgac
ggcacgaaagcgcacgtcgagaagcggctgccgcgcgcgattgacgcgttcaagcggatg
acgcagttctcgccgtacgtgctcggcgattcgttcggtctcgccgatatcgcggcatcg
atccatttgccgatcgtcgcgatggcgacgaagacgatcttcggccgcgatttcgtgctc
gatgcgggcatcgactggaaggcgcatgcgaagaaggtcggcgagcgaccggccgcgcag
cgcgtcgcggcggaccgcaaggcctacatggaggctgcgagcgccgcgcgcgcgtaa

DBGET integrated database retrieval system