KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1747Help
Entry
Bmul_1747         CDS       T00624                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00020  Citrate cycle (TCA cycle)
bmu00310  Lysine degradation
bmu00380  Tryptophan metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_1747
  Amino acid metabolism
   00310 Lysine degradation
    Bmul_1747
   00380 Tryptophan metabolism
    Bmul_1747
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Bmul_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABX15435
UniProt: A0A0H3KEJ0
LinkDB All DBs
Position
1:complement(1929800..1932664)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEEQYEAYLDNPASVPENWREYFDALQNVPATDGSNASD
VAHYPIVESFAQRAKANAFIPRESGTNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEFMYI
SDPEQKRWWQERLESIRATPNFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGAQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDAEAYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMAEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEIDGGIDAKKVKRVLVCSGRVYY
DLVAHRRETKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcctatttgttcggcggcaatgcttcg
tacgtagaagaacagtacgaagcatatctcgataatccggcgtcagtgcccgagaactgg
cgagagtatttcgacgcgttgcagaacgttcctgcgacggacggttcgaacgccagcgac
gtggcgcattacccgatcgtcgagtcgttcgcccagcgcgcgaaggccaatgccttcatt
ccgcgcgaaagcggtaccaatctggcaacggcgcgcaagcaagtccatgtccagtccctc
atcagcgcctatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgtcgc
gaacgtcccgccattcccgaactcgaacccgcgttctacgacttctccgaagccgacctc
gaccagacgtacagcgcaagcaacctgtacttcggtttcgaccaggcatcgctgcgcgac
atcgtgaagggcctgcgtgacacgtactgcggcacgatcggcgccgagttcatgtacatc
agcgatccggaacagaagcgctggtggcaggagcgtctcgaatcgatccgcgcgacgccg
aatttctcggccgacaagaagaagcacatcctgaaccgcctgacggctgcggaaggcctc
gagcgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagaagggcgtgcaggaa
atcgtgatcggcatggcccaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggcggacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggt
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggttcac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcc
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcgcgcaagtgctgccggtgcag
atccacggcgacgcggcctttgccggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgtgctcgcg
acgcagatcgcgatcgactaccgcatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgcgcgctgtacgcggagaagctcgtgcag
cagggcgtgatcaccgccgaggacgccgaagcttacgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaaccgcaagtggacggacgcagctgatacggccgtgccgctc
gccgaactgaagcgtctcggcgaacgcatcacgacggtcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgatcgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatggccgagcacctcgcgttcgcgtcgctcgtcgcatcgggctatgcagtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgcggaa
ggccaggcgaagttcacggtgatcgactcggtgttgtcggaagaagcggtgctgggcttc
gaatacggctactcgacggccgagccgaatacgctcgtgctctgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctcacgatgctgctgccgcacggctacgaaggccagggtccg
gagcactcgtcgacccgcatcgagcgtttcctgcagctgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgtcgccagatgatccgt
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagca
gtgtcggatctgtcggagctcgcgaagggttcgttccagccggtgctgggcgaaatcgac
ggcggtatcgacgcgaagaaggtcaagcgcgtgctggtgtgctcgggccgcgtgtactac
gacctcgtcgcgcaccgccgcgaaacgaaggcgaacgacgtcgcgatcatccgtatcgaa
cagctgtatccgttcgcgcacaagcagttcgaagctgaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tcggcctcgccggcggtcggctactacgcgaagcactacgagcagcagaaggccctcgtc
gaaggtgcattcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system