KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_1793Help
Entry
Bmul_1793         CDS       T00624                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Bmul_1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR_2 MarR
Motif
Other DBs
NCBI-ProteinID: ABX15481
UniProt: A0A0H3KEQ7
LinkDB All DBs
Position
1:complement(1982707..1984035)
Genome map
AA seq 442 aa AA seqDB search
MPKLSVDLDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFA
SFQISLQGFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAF
NLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWL
LTLASLPLTVLAFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTA
VYGAFAALPVFLLWMYLSWFIALLGAMVTSALPAIRIGQFHRVDYPGSDLLDALELLARL
AEARAAGKPGRSAIRLATMLRCDMQTAQRLLTLLEEREWVARLEGGEDSPRYILLANPER
LTLAQLFDVLVIDRAELTYQLQRRRSHIDGGALLAVLSSERFDVTLASLIAPHRLSGAQP
AAASEPAADDAPEPHAHPPRTA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagttgagcgtcgatctcgacaccatcaagcgtctcgcgcagttcgccgcgcgg
cgcagcgccgaagaccgcatcccgcaggtggcgggcagcctcacgttcacgacgatgctg
gcgctcgtgccgctcgtgacggtggcgttcgcgctgttcaccgcgtttccgatgttcgcg
tcgttccagatctcgctgcagggcttcctcgccgatcacctgatgcccgcgcagttcaac
atccagatcttcaagtatctgaaccagttcgcggcgaaggcgaaggggctgacgacggcc
ggcctgatcgtactggtcgtcacgtcggtgatgacgatgatgacgatcgagtccgccttc
aacctgatctggcgcgtgcgcaagccgcgcccgttcgcgcagcgcgtgctcgcgtactgg
gcgctgatcacgctcgggccgctgctgttcggcgtgagtctgtcgctgtcgtcgtacttg
tttacgcagtcgcttgcgtttacgggcgcggcgccgtcgacgtcgatcgtcgaatggctg
ctcacgctcgcgtcgctgccgctcacggtgctcgcgttcacgctgctgtacgtctatctg
ccgaactgcacggtcgcgtggcgcgacgcggtgatcggcgggttgttcgccgccgtcgca
ttcgagctggcaaagcgcggcttcggctactacgtgcggcgcattccgacgtatacggcc
gtctacggcgcgttcgccgcgctgcccgtgttcctgttgtggatgtatctgagttggttc
atcgcgctgctcggcgcgatggtcacgtccgcgctgccggcgatccggatcggtcagttc
caccgcgtcgactatccgggcagcgacctgctcgacgcgctcgaactgctcgcgcggctc
gccgaagcgcgcgcggccggcaagccgggccgcagcgcgatccggctcgcgacgatgctg
cgctgcgacatgcagacggcgcagcgcctcctgaccttgctggaagaacgggaatgggtc
gcgcgcctcgagggcggcgaggactcgccgcgctacatcctgcttgcgaatcccgagcgc
ctgacgctcgcgcagctgttcgacgtgctcgtgatcgaccgcgcggagctcacgtatcag
ttgcagcggcggcgcagccatatcgacggcggcgccttgctcgcggtgctgtcgagcgag
cgcttcgacgtgacgctcgcgtcgctgatcgccccgcaccggctgtccggcgcgcagccg
gccgcggcgtccgagccggcggcggacgacgcgccggagccgcacgcgcatccgccgcgc
accgcgtga

DBGET integrated database retrieval system