KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2373Help
Entry
Bmul_2373         CDS       T00624                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00970  Aminoacyl-tRNA biosynthesis
bmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bmul_2373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmu03029]
    Bmul_2373
Enzymes [BR:bmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bmul_2373
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bmul_2373
Mitochondrial biogenesis [BR:bmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bmul_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABX16058
UniProt: A0A0H3KLI7
LinkDB All DBs
Position
1:2585187..2586563
Genome map
AA seq 458 aa AA seqDB search
MTTFTPFPPLAQLAADLAAGTTTSRALVDAALERIADPSGQGAVVFTEVDADNARAAADA
HDRLRAAGTVLSPLAGIPVSIKDLFDVAGQVTRAGSRVLDDAPPARADAVAVARVRRAGA
VLVGRTNMSEFAFSGLGLNPHFGTPASPYRRDVPGDARIAGGSSSGAAASVADGMAAVAL
GTDTGGSIRIPAALCGLTGFKPTASRVPTQGGVPLSTTLDSFGPIGVTVACCALVDRMLA
GLEPSVPAARPLEGVRLGVPTNYVTDGVDADVAAALDTALKHLEAAGAIVTEVRFSALDR
LPEINRFGFSPIEAYAWHRPLLAEHRDRYDPRVLMRILKGEPATAADYLDLLAARRAMLD
EAAHTVWARFDALVAPTVPIVPPRIAELEADDAAFTRTNALILRNPSAFNFLDACALSLP
CHPRDGAPVGLMLAAAPHRDDALLAIGQSVEAVLNTIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttcacgcccttccccccgctcgcccagctcgccgccgatctcgccgccggc
acgaccacgagccgcgcgctcgtcgacgccgcgctcgaacggatcgccgatccgtccggc
cagggcgccgtcgtcttcaccgaagtcgatgcggacaacgcgcgcgcggccgccgacgca
cacgaccggctgcgggccgcgggcaccgtgctgtcgccgctcgcgggcatcccggtgtcg
atcaaggatctgttcgacgtcgccggacaagtcacgcgcgccggctcgcgcgtgctcgac
gacgcgccgcccgcgcgcgccgatgcggtcgcggtcgcgcgggtgcgccgtgcgggcgcg
gtgctggtcggccgcaccaacatgagcgagttcgcgttctcggggctcgggctcaatccg
cacttcggcacgcccgcatcgccgtatcggcgcgacgtgccgggcgatgcacgcatcgcg
ggcgggtcgtcgtcgggcgcggccgcgtcggtcgccgacgggatggcggccgtcgcgctc
ggcaccgacaccggcggctcgatccgcattccggccgcgctgtgcgggctgaccggcttc
aagccgaccgcgagccgcgtgccgacgcaaggcggcgtcccgctgtcgacgacgctcgat
tcgttcgggccgatcggcgtaacggtcgcatgctgcgcgctcgtcgaccgcatgctcgcc
ggcctcgagccgagcgtgccggccgcgcggccgctcgaaggcgtgcggctcggcgtgccg
acgaactacgtgaccgacggcgtcgacgccgacgtcgcggccgcgctcgataccgcgctc
aagcatctggaagcggccggcgcgatcgtcaccgaagtgcggttctccgcgctcgaccgg
ctgccggagatcaaccgcttcggcttctcgccgatcgaggcgtacgcgtggcaccgtccg
ctgctcgccgagcatcgcgaccgctacgacccgcgcgtgctgatgcgcatcctgaagggc
gagccggccaccgcggccgactatctcgatctgctcgcggcgcgccgcgcgatgctcgac
gaagccgcgcacacggtgtgggcgcgcttcgatgcgctggtcgcgccgacggtgccgatc
gtgccgccgcgcatcgcggagctcgaagccgacgacgccgcgttcacgcgcaccaatgcg
ctgatcctgcgcaatccgagcgcgttcaacttcctcgatgcctgcgcgctgtcgctgccc
tgccatccgcgcgacggcgcgccggtcgggctgatgctcgcggccgcgccgcaccgcgac
gatgcgctgctcgcgatcggccagtcggtcgaggccgtgctgaacacgatccgctga

DBGET integrated database retrieval system