KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3184
Entry
Bmul_3184         CDS       T00624                                 

Definition
(GenBank) hopanoid biosynthesis associated RND transporter like protein HpnN
  KO
K07003  uncharacterized protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Bmul_3184
SSDB
Motif
Pfam: MMPL
Other DBs
NCBI-ProteinID: ABX16868
UniProt: A0A0H3KP92
LinkDB
Structure
PDB: 
5KHN 5KHS

Position
2:complement(40504..43137)
AA seq 877 aa
MVTSLIVRLVAWSVRRPVWVVVLSLLIAAFSGVYVARHFKINTDISKLVDAEPQWAALSQ
AVDRAFPQRNGTILAVVEAPAPEFATAAAHALTESLQKQAAAGRIGPVAEPGGGPFFEHN
GLLFLSPQQVADTTSQLASARPLVNELAKNPSLTGLATTLSTTLGQPLLTGQVKLPSMAK
LLSRSAATVDDVLAGKPAAFSWRALVDNDAARQPARAFVTVQPVVNYGALKAGAQTSDVI
RETARALDLEKRYGAVVRLTGEQPLADDEFSSVEDGAALNGVVTLLVVFVILWLALRSKR
MIASVLVTLFVGLVVTAALGLAMVGSLNMISVAFMVLFVGLGVDFSIQYGVKYREERFRD
ERIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRGVSELGLIAGVGMFVALLTTLT
LLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPILIGTLAVVIGALPLLAFLHFDFN
PLHLKDPHSESMSTLLALKDSPEAAVNDVTLLAPSLADADAAAKRLDALPEVGRTTTLST
FIPADQPEKRAAIATAASTLLPALTQPPAPPATDAQRVAALKRASDLLGYAAEDHPGPGA
AAAQHLSQSLAKLAAADSATRDRAERAFADTLRIALNQLAALLQPQEITRDTLPPPLVRD
WVAPDGKALVQISPKVPKGVDPNDDTMLRHFATAVKAAEPGAIGGPISILHSANTIISAF
LHAALWSIISITILLWITLRRFGDVLRTLVPLLVSGIVTLEMCVVLGMSLNFANIIALPL
MLGVGVAFKVYFVMAWRAGQTGLLHSSLTHAVLFSAATTATAFGSLWLSHHPGTSSMGKL
LALALTCTLIGAVVFQPVLMGKPRVKRAKNQSQGINE
NT seq 2634 nt   +upstreamnt  +downstreamnt
atggtgacatctctcatcgtccgactcgtcgcgtggtcggtacgacgcccggtctgggtc
gtcgtactgtcgctgctgattgccgcgttcagcggcgtctatgttgcgcgtcacttcaag
atcaataccgacatcagcaagctggtcgatgcggagccgcaatgggcggcgctcagtcag
gcggtcgatcgcgcgttcccgcagcgcaacggcacgatcctcgcggtcgtcgaggcgccc
gcgcccgagttcgccaccgcggccgcgcatgcgctgaccgaatcgctgcagaagcaggcc
gcggccggccggatcggccccgtcgccgagccgggcggcggtccgttcttcgagcataac
gggctgctgttcctgtcgccgcagcaggtcgccgacacgacgtcgcagctcgcgagcgcg
cgcccgctcgtcaacgaactcgcgaagaatccgagcctcacggggctcgcgacgacgctg
tcgacgacgctcggccagccgctgctgaccgggcaggtgaagctgccgtcgatggcgaag
ctgctctcgcgcagcgccgcgaccgtcgacgacgtgctcgccggcaagcccgccgcgttc
tcgtggcgcgcgctcgtcgacaacgatgccgcgcggcagccggcgcgcgcgttcgtgacc
gtgcagccggtggtcaactacggcgcgctgaaggccggcgcgcagacgagcgacgtgatc
cgcgaaaccgcgcgcgcgctcgatctcgagaagcgctacggcgccgtcgtgcggctgacc
ggcgaacagccgctcgccgacgacgaattctcgtcggtcgaagacggcgcggcgctgaac
ggcgtcgtcacgctgctcgtcgtgttcgtcatcctctggcttgcgctgcgctcgaagcgc
atgatcgcgtcggtgctcgtcacgctgttcgtcgggctcgtcgtcaccgcggcgctcggc
ctcgcgatggtcggctcgctgaacatgatctcggtcgcgttcatggtgctgttcgtcggc
ctcggcgtcgacttctcgatccagtacggcgtgaagtatcgcgaagaacgctttcgcgac
gagcgcatcgatcacgcgctgatcggtgccgcgcactcgatggggatgccgctcgcgctc
gccaccaccgccgtcgcggcgagcttcttctcgttcattccgaccgcgtatcgcggcgtg
tcggagctcgggctgatcgccggcgtcgggatgttcgtcgcgctgctgacgacgctgacg
ctgctgcccgcgctgctgcgcctgttcgcgccgccgggcgaatcgaagacgccgggcttt
ccgtggctcgcgcccgtcgacgactatctcgatcgccaccgcaagccgatcctgatcggc
acgctcgcggtcgtgatcggcgcgctgccgctgctcgcgttcctgcatttcgacttcaac
ccgctgcatctgaaagacccgcacagcgaatcgatgtcgacgctgctcgcgctgaaggat
tcgcccgaagcggccgtcaacgacgtgacgctgctcgcaccgtcgctcgccgatgccgac
gcggccgcgaaacgcctcgacgcgctgcccgaagtcggccgcacgacgacgctgtcgacg
ttcatccccgccgatcagccggaaaaacgcgcggcgatcgcgacggccgcgagcacgctg
ctgcccgcgctcacgcagccgcccgcgccgcccgccaccgacgcgcagcgcgtcgccgcc
ctcaagcgcgcgtcggatctgctcggctacgcggccgaagatcatccggggccgggcgcc
gcggccgcgcagcacctgtcgcagtcgctcgcgaaactcgcggccgccgacagcgcgacg
cgcgaccgcgcggagcgcgcgttcgcggacacgctgcgcatcgcgctgaaccagctcgcg
gcgctgctgcagccgcaggagatcacgcgggacacgctgccgccgccgctcgtgcgcgac
tgggtcgcgcccgacggcaaggcgctcgtgcagatttcgccgaaggtgccgaagggcgtc
gacccgaacgacgacacgatgctgcgccacttcgcgaccgccgtgaaggcggccgaaccg
ggcgcgatcggcgggccgatctcgatcctgcattcggcgaacacgatcatcagcgcgttc
ctgcacgcggcgctgtggtcgatcatctcgatcacgatcctgctgtggatcacgctgcgc
cgcttcggcgacgtgctacgcacgctggtgccgctgctcgtgtcggggatcgtcacgctc
gagatgtgcgtggtgctcggcatgtcgctgaacttcgcgaacatcatcgcgctgccgctg
atgctcggcgtcggcgtcgcgttcaaggtgtatttcgtgatggcgtggcgcgcggggcaa
accggcctgctgcattcgagcctgacccacgcggtgctgttcagcgccgcgacgaccgcg
accgcgttcggcagcctgtggctgtcgcatcatccgggtacgtcgagcatgggcaagctg
ctcgcgctggcgctgacctgtacgctgatcggcgccgtcgtgtttcagcccgtcctgatg
ggcaaaccgcgcgtgaagcgcgcgaagaaccaatcgcaaggaatcaatgaataa

DBGET integrated database retrieval system