KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3185
Entry
Bmul_3185         CDS       T00624                                 

Definition
(GenBank) toluene tolerance family protein
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bmul_3185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmu02000]
    Bmul_3185
Transporters [BR:bmu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter
    Bmul_3185
SSDB
Motif
Pfam: MlaC
Other DBs
NCBI-ProteinID: ABX16869
UniProt: A0A0H3KPM6
LinkDB
Position
2:43456..44052
AA seq 198 aa
MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAARGGDMAKITQVVEQR
FLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAASLAQLGNQDAKFSFKA
GGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSGAWLIQVYQGQFKSQLAS
GGIDGLIAYLQKHNSRTN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaacgtcatctgtttgctttcctcgccgcggccgccgtgtcggtttccgctttcgcg
cagagcgcgccggtcgacatcgtccgccatgcggtcgaaggcaccgtcaatgcgatgaag
gccgatccggccgcgcgcggcggcgacatggcaaagatcacgcaggtcgtcgagcagcgc
ttcctgcccgcgacgaacttcgagcgcacgacgcgcatcgcggtcggcgacgcgtggaag
caggcgacgccgcaacagcagcaggagctctacaagcagttccggctgctgatgacgcgc
acgtacgccgcgtcgctcgcgcagctcggcaaccaggacgcgaagttctcgttcaaggcg
ggcggcacgtcgggcgccgacgcgctcgtgcagtcgacggtcacgacgccgggcgacagc
cagtcggtcggctaccggctcggcaaggtcggcaacgactggaagatctacgacatcgac
atgtccggtgcgtggctgatccaggtctatcaggggcagttcaagagccagctcgcgtcg
ggcggcatcgacggcctgatcgcgtatctgcagaagcacaattcccgcacgaactga

DBGET integrated database retrieval system