KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3189
Entry
Bmul_3189         CDS       T00624                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00620  Pyruvate metabolism
bmu00630  Glyoxylate and dicarboxylate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01200  Carbon metabolism
Module
bmu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bmul_3189
   00630 Glyoxylate and dicarboxylate metabolism
    Bmul_3189
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bmul_3189
SSDB
Motif
Pfam: Malate_synthase
Other DBs
NCBI-ProteinID: ABX16873
UniProt: A0A0H3KP87
LinkDB
Position
2:complement(48445..50619)
AA seq 724 aa
MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAPRNRELLAERDRLQSE
LDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDNGAERTATYNPTRGQRVIDYARNVLDNAAPLA
GASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
SKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGHLMTIGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMIRKGDMKSSAWI
AAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELERTPYASERDALLDGLLTVPVVERAAWSDEEILREVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPDYDRSVAFQAACALALHGTSQPSGYTEPLLHRFRLAFKAQ
QAQA
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatcgaccatgacggactgcaagtcgcgccagcgctgagccagttcatcgaaaacgaa
gcgctgccgggcaccggcatcgaccaagccgcgttctggcgcggcttctccgcactggtg
cacgaccttgcgccgcgcaaccgcgaactgctcgccgagcgcgaccgtctgcaaagcgaa
ctcgacgcctggcatcgcgcgcaccccggcccggtgcgcgacctcgccgcgtatcgcgcg
ttcctcgagcagatcggctacctggtgccgacgccggccgacgtcgcggccacgaccgcg
aacgtcgacagcgaaatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgcggcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacaacggcgccgagcgcaccgcaacgtacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctggcc
ggtgcgtcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgccgtcgag
accggcaagggcatcgtgcacctcgcgcagcccgcgcaattcgtcggctaccagggcgcg
gccgatgcgccctccgcgatcctgctgaagcacaacgggctccatctcgagatccagatc
gacggctcgacgccgatcggccgcgcggacgtcgcgaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggattcggtcgcggccgtcgacgccgaggac
aaggtgcagctgtaccgcaactggctcgggctgatgcagggcacgctggtggaggaagtg
tcgaagggcggcaagacgttcacgcgccgcctgaacgcggaccgcgaatacacgacgccc
gacggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcgggcac
ctgatgacgatcggcgcggtgctcgatcgcgacggcaacgagattccggaaggcatcctc
gatggcgtcgtcacgacactctgcgcgctgcacgacctgaagtcgaagcgcaattcgcgc
accggctccatctacatcgtgaagccgaagatgcacggcccggccgaagtcgcgttcgcc
gatacgctattcgcgcgcatcgaggatctctacgggctgccgcgcaatacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcctgcatcgcggccgcc
gccgcgcgcgtcgcattcatcaacacgggcttcctcgatcgcaccggcgacgagatgcac
agcgcgatggaagcgggaccgatgatccgcaagggcgacatgaagtcgtccgcatggatc
gccgcgtacgagcgcaacaacgtgctcgccgggctgtcggccggactgcgtgggcgcgcg
cagatcggcaaggggatgtgggcgatgcccgacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgcgggcgcgaacaccgcgtgggtgccctcgccgaccgccgcgacg
ctgcatgcgctgcactaccatctcgtcgacgtgcaggccgtccagcaggaactcgaaagg
acgccgtacgcgagcgagcgcgacgcgctgctcgacgggctgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgacgaagagatcctgcgcgaagtcgaaaacaacgcgcagggc
attctcggctacgtcgtgcggtgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgtcacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgtccgatggcgccc
gactacgaccggtcggtcgcgttccaggctgcctgcgcgctcgcgctgcacggcacgtcg
cagccgagcggctatacggagccgctgctgcaccggttccggcttgcgttcaaggcgcag
caggcacaggcctaa

DBGET integrated database retrieval system