KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3364Help
Entry
Bmul_3364         CDS       T00624                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00250  Alanine, aspartate and glutamate metabolism
bmu00280  Valine, leucine and isoleucine degradation
bmu00410  beta-Alanine metabolism
bmu00640  Propanoate metabolism
bmu00650  Butanoate metabolism
bmu01100  Metabolic pathways
bmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bmul_3364
   00650 Butanoate metabolism
    Bmul_3364
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bmul_3364
   00280 Valine, leucine and isoleucine degradation
    Bmul_3364
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bmul_3364
Enzymes [BR:bmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bmul_3364
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Bmul_3364
Amino acid related enzymes [BR:bmu01007]
 Aminotransferase (transaminase)
  Class III
   Bmul_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABX17048
UniProt: A0A0H3KNX6
LinkDB All DBs
Position
2:complement(252543..253832)
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIAEQLELFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLNALQAEVPQIADVRGPGAMIAVEF
MKPGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALAILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgctggcccgcaagaacgccgcgaccccgcgcggcgtc
ggagtgatgtgcgacttctacgccgcccgcgccgagaacgcggagctgtgggacgtcgaa
ggccgccgtttcatcgatttcgccgcgggcatcgcggtgctgaacacgggccatcgtcat
ccgaagatcgtcaaggcgatcgcggagcagctggagctcttcacgcacaccgcctaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgaaaagatcaacgaacgcgcgccgggc
gacttcccgaaaaagacggcgttcttcacgaccggtgccgaagccgtcgaaaacgcgatc
aagatcgcacgcgcggcaacgggccgtccgggcgtgatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggtccgttcccgggcgacgtgttccacgcaccatacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gagttcgtccgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggccgccccgggcggcctcggcggcacgtacgcg
ggcaacccgctcgcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagaaaag
ctgtgcgagcgcgcgacgcagctcggcgacacgctgaaggcgaagctgaacgcgctgcag
gccgaggtgccgcagatcgccgacgtgcgcggcccgggtgcgatgattgcggtcgagttc
atgaagccgggcaccggcgagccggacgccgaattcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcgggctgctgctgctcgtctgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgcgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system