KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3921
Entry
Bmul_3921         CDS       T00624                                 

Definition
(GenBank) type VI secretion system OmpA/MotB family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bmul_3921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmu02044]
    Bmul_3921
Secretion system [BR:bmu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bmul_3921
SSDB
Motif
Pfam: DotU OmpA Guanylate_cyc
Other DBs
NCBI-ProteinID: ABX17604
LinkDB
Position
2:889798..891093
AA seq 431 aa
MSRAKYLAGERHDVTVAVDVPTFADIVDSDRNRKTYVIPPGEAESQRLNAIRLARNPLLE
AARPLLRAQADMPDTLAGPASELLRKMLEHELRIFQKLCEQANIRRDHMIGARYCLCTAL
DEAAMRTEWGRSGSSGCEWGNRSLATTFHEDRDGGEKVYLLIGRLMQAPDEHRDLLEVIY
RILSLGFEGRYQDVADGKRKHDAIRQRLYTEITSQRDPVPLTLSRHWQPGTKGKRPSFYD
FPVWITATLLSVVLLGLFGWFKYELSNHSADVQKQIADIARMTPPPAPPPQLHLKQLLKD
EIAAGTVSVDEDARRSVVTFRGDAMFRPGGASVQASMNPLIAKIAAEIAKVPGKVTIVGY
TDNVPIRSGQFASNQALSEERATQVMQMLQAAGVPANRLEAVGKGDADPVGDNRTAQGRA
QNRRVEIDVAR
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagccgcgcgaaatacctggctggcgaaagacacgatgtaacggttgccgtcgacgtt
ccgacgttcgcagatatcgtcgattccgaccgaaacaggaagacttacgtgattccaccg
ggcgaagcagagtcgcagagactgaatgcgatcaggctggcgcggaatcctttgcttgag
gcagcgcgtccgctattgagagcgcaggcggatatgcccgacaccctggcaggtcctgca
agtgagcttctgcgcaagatgctggagcacgagctgcgcatctttcagaaactgtgcgag
caggccaacattcgccgcgatcatatgatcggcgcacgatactgcctctgcacggcgctt
gacgaggccgcgatgaggacagagtggggccgcagtggatcttccgggtgcgaatggggt
aaccgcagccttgcgacaacattccatgaggatcgcgacggcggtgaaaaagtttatctg
ctgatcggccggctgatgcaggcgcctgacgagcatcgcgatctgctggaggtgatttat
cggatcctcagtctaggctttgaaggacgctaccaggacgttgccgacggcaagcgcaag
cacgacgccattcgccaacggctttacaccgaaatcacatcgcaacgcgaccccgtgccg
ttgactttgtcccgccactggcaacccggcacaaagggcaagcgcccgtcgttctacgat
ttccccgtgtggattaccgcaacgcttttgtcggtggtcctgctcggcctgttcggatgg
ttcaagtacgaactctccaatcacagcgcggacgttcagaagcagattgccgacattgcc
cgcatgacgccgccgcctgcgccgccgccgcaactgcacctcaagcagttgctcaaggat
gaaatcgccgccggcacggtcagcgtcgacgaggacgctcgccgcagcgtcgtcacgttc
cgcggcgacgcgatgttccggcccggtggcgcctctgtccaggcctcgatgaatccgctg
atcgcgaagatcgcggcagagatcgccaaggttcccggcaaggtcacgatcgtcggctac
acggacaacgtgccgattcgcagcggccagttcgcgtcgaatcaggcgctgtcggaagag
cgggccacccaggtcatgcagatgctgcaagccgctggcgtaccggcgaaccgcctggaa
gccgtcggcaagggcgatgccgatccggtcggcgacaaccgcaccgcgcagggccgcgcg
caaaaccgccgtgtcgagatcgacgtcgcacgataa

DBGET integrated database retrieval system