KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4259Help
Entry
Bmul_4259         CDS       T00624                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00550  Peptidoglycan biosynthesis
bmu01100  Metabolic pathways
bmu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bmul_4259
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bmul_4259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bmu01003]
    Bmul_4259
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmu01011]
    Bmul_4259
Enzymes [BR:bmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Bmul_4259
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bmul_4259
Glycosyltransferases [BR:bmu01003]
 Polysaccharide
  Bacterial polysaccharide
   Bmul_4259
Peptidoglycan biosynthesis and degradation proteins [BR:bmu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Bmul_4259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABX17940
LinkDB All DBs
Position
2:complement(1296036..1298702)
Genome map
AA seq 888 aa AA seqDB search
MRRRACAARRGVARVLVRCCLSSRSPTRVNRRNESSVRDLLAQWVARAQPAAAAAAVPVK
RMLATGWHHLRHPTRRGVLLAAAAVPALFALYVLALVPFTPGIGDIRKARVDQPARVLSA
DGKLLAEFKPSNREWVPLAQISPHVVDALIATEDHRFYQHHGLDWRRTASAALHTFSGDR
QGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITALKIEAVYSKDQILETYLNTVPFLYN
AYGVEMAARTYFDKSADELDVLDSATLVGMLKGNSYYNPVLNPERALQRRNTVLGQMVKY
GKLTPAQFAQLQRRPLRIDFERQKEPPGPAPHFAQQLRKWLIAWADRNDYNIYSDGLIVR
TTIDARLQQMATQALILQTNELQRIANNAWSGRDGCGTDNEVFRAFMRESPEYKAAQDAG
KDDAAAMKALAADRGFMRALCKAKTDVQAGFVAIDPRDGQIRAWVGSRDFASEPFDHVAQ
ARRQPGSTFKAFVYGAAFERGMKPDDTFVDQPVEIPLKGGEVWRPNDDVPPTGKPMTLRD
ALALSRNRITAQVMEKVGPAAVARLARDMGVRESPLERVPSLALGTSPVTLKEMVASYAT
IANDGLYVEPHMVTRIENRNGDVLAEFAPAPPERALDAEADKTLLDTMRNVVTRGTGASI
RTRFGVRGDVAGKTGTTQDNADGWFILMQPALVAGAWVGFDDGRVTLRSDYWGQGAHSAL
PIVGDFFQRAQRARLIDPKATFDTEPSPGWFASVRERVTDLFDTWFRPEPNKVAVPVKVQ
RTPRKPEPAESGTASSEAAASAAAAASDGIVEEWVPASEVAASAAALSGAGSQPQAQPQP
PAQPPAAPAPGVTMPGGAGSGSAASPVAPAAPLQPSTPGAPDAGDGAQ
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgccgggcgtgcgccgcgcggcggggcgtcgcgcgagttttggtacgatgctgc
ctttccagcagatccccgacccgcgtgaatcgccgaaacgagtcgtccgtgcgcgacctt
cttgcccaatgggttgcgcgcgcgcaaccggccgcggccgccgccgccgtgcccgtcaag
cgtatgctggccaccggctggcaccatctccgtcatccgacgcgccgcggcgtgctgctt
gcggccgccgccgtgcccgcactattcgcgttgtacgtgctcgcgctcgtgccgttcacg
cccggcatcggcgacatccgcaaggcgcgcgtcgatcagccggcgcgcgtgctgtcggcg
gacggcaagctgctcgccgagttcaagccgtcgaaccgcgaatgggtgccgctcgcgcag
atctcgccgcacgtggtggatgcgctgatcgcgaccgaggatcaccggttctaccagcat
cacggcctcgactggcggcgcaccgcgtcggccgcactccacacgttctccggcgaccgg
cagggcggctcgacgatcacgcagcagctcgcgcgcaatctgtatccggacgagatcgga
cgcgcgccgacgctcacgcgcaagctgaaggaggcgatcaccgcgctgaagatcgaggcc
gtgtacagcaaggaccagatcctcgagacctacctgaacacggtgccgttcctctacaac
gcgtacggcgtcgagatggccgcgcgcacctacttcgacaagtcggccgacgagctcgac
gtgctcgacagtgcgacgctcgtcggcatgctgaaaggcaacagctactacaacccggtg
ctgaaccccgaacgcgcgctgcagcggcgcaatacggtgctcggccagatggtgaagtac
gggaagctgacgcccgcgcagttcgcgcaactgcagcgccggccgctgcggatcgacttc
gagcggcagaaggagccgccggggccggcgccgcactttgcgcagcagctgcgcaaatgg
ctgatcgcgtgggccgaccgcaacgactacaacatctattcggacgggctgatcgttcgc
acgacgatcgacgcgcggctgcagcagatggcgacgcaggcgctgatcctgcagacgaac
gaactgcagcgcatcgcaaacaacgcctggagcggccgcgacggctgcgggaccgacaac
gaagtgttccgcgccttcatgcgcgaatcgcccgaatacaaggccgcgcaggatgccggc
aaggacgacgcggccgcgatgaaggcgctcgccgcggatcgcggcttcatgcgtgcgctg
tgcaaggcgaagaccgacgtgcaggccggcttcgtcgcgatcgatccgcgcgacgggcag
atccgcgcgtgggtcggcagccgcgacttcgcgagcgagccgttcgaccatgtcgcgcag
gcgcggcgccagccgggctcgacgttcaaggcgttcgtgtacggcgctgcgttcgagcgc
ggcatgaagcccgacgacaccttcgtcgaccagccggtggagatcccgctgaaaggcggc
gaggtatggcggccgaacgacgacgtgccgccgaccggcaagccgatgacgctgcgcgat
gcgctcgcgctgtcgcgcaaccggatcacggcgcaggtgatggagaaggtcggccccgcg
gcggtcgcgcggctcgcgcgcgacatgggcgtgcgcgagagtccgctcgagcgcgtgccg
tcgctcgcgctcgggacgagccccgtgacgctgaaggagatggtcgcgtcgtacgcgacg
atcgcgaacgacgggttgtacgtcgagccgcacatggtgacgcggatcgagaaccgcaac
ggcgacgtgctggccgagtttgcgccggcgccgccggaacgcgcgctcgacgcggaagcc
gacaagacgctgctcgacacgatgcgcaacgtcgtcacgcgcggcaccggcgcgagcatc
cgcacgcgcttcggcgtgcgcggcgacgtggccggcaagaccggtacgacgcaggacaac
gcggacggctggttcatcctgatgcagcccgcgctcgtcgccggcgcgtgggtcggcttc
gacgacggccgcgtgacgctgcgcagcgactactgggggcagggcgcgcacagcgcgctg
ccgatcgtcggcgatttcttccagcgtgcgcaacgcgcgcggctgatcgatccgaaggcg
accttcgatacggagccgtcgccgggctggttcgcgtcggtgcgcgagcgcgtgacggac
ctcttcgacacgtggttcaggcccgagccgaacaaggtcgccgtaccggtcaaggtccag
cggacgccgcgcaagcccgagccggccgagagcggtacggcgtcgagcgaagcggctgcg
tcggccgccgctgccgcgtcggacggcatcgtcgaggaatgggtgccggcgtccgaagtg
gcggcgtccgctgccgcgctgtcgggtgcaggttctcagcctcaggcgcagccgcagccg
ccggctcagccgcctgcggcgcccgcgccgggcgtcacgatgccgggcggcgcgggcagc
ggcagcgcggcgtcgccggtcgcgcctgcggcgccgctgcagccgtcgacgcccggtgcg
ccggacgccggcgacggcgcacagtaa

DBGET integrated database retrieval system