KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4471
Entry
Bmul_4471         CDS       T00624                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00440  Phosphonate and phosphinate metabolism
bmu00998  Biosynthesis of various secondary metabolites - part 2
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bmul_4471
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    Bmul_4471
Enzymes [BR:bmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bmul_4471
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: ABX18150
UniProt: A0A0H3KUG3
LinkDB
Position
2:1546515..1548203
AA seq 562 aa
MNAREPNFTESRSARLRRMLLSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAVVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFAFCSAADDRGLFGQKVLLQRVSSDAAAGTPHGRWIGLLNV
RGAGVERLKAMLATLQARADFDTLDIPALLNALIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPMSEPGAGNGGAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccggatgctg
ctgagcaacgaactcgaattcctgatggaagcccacaacggcctgtccgcacgcatcgtg
cgcgaagccggcttcaagggcatctgggcctccggcctcgcgatctccgcgcagttcggc
gtacgcgacaacaacgaggcaagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaagcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcctatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatcggcgatgcaggccgtcgcccgcgag
atccacgaaagcgaaacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgtttgcaggacgccgacgaatactcggcggccgagcgtatctacctgtcgtcgtca
tcgcgcgcgtcgaacgcggcggtcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgcccgttgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtcgtcggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccacgccgaaacg
ggcgagctcgcatcgctcgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgatctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggtgctgctccagcgc
gtgtcgagcgatgccgccgccggcacgccgcacggccgctggatcggtctgctgaacgtg
cgcggcgccggtgtcgagcgtctgaaggcgatgctcgcgacgctgcaggcacgcgccgat
ttcgacacgctcgacatccccgcgctgctcaacgcgctgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgatgtccgagccgggcgccggcaacgggggc
gcacgatga

DBGET integrated database retrieval system