KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4496Help
Entry
Bmul_4496         CDS       T00624                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bmul_4496
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bmul_4496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like Glutaredoxin K_oxygenase FAD_oxidored Thi4 DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABX18175
UniProt: A0A0H3KUD6
LinkDB All DBs
Position
2:1578052..1579650
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLEKITRPIELVASLDDSAKSQELRALLDEIASLTTRVTVIERRDDEA
RTPSFSIGEPGQPARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKARTVVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTVITEAQTTELTGDGSKL
NGLVYTDRRSGEVKRIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPAVDTQPQADEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagacccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcatcgctcgacgacagcgcgaagtcgcaggaactgcgtgcgctgctc
gacgagattgcatcgctgacgacgcgcgtcaccgtgatcgaacgccgcgacgacgaggcg
cgcacgccgtcgttctcgatcggcgaaccgggccagcccgcgcggatccgcttcgcgggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccggtcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcg
ttcgagacgtacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgaagcacgccagatcatggcggtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccggc
gcacgcgcggcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggcggccgcgatctactcggcgcgcaagggcatcgcgaccggcgtg
gtcgccgaacgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaaggaccgaagttcgcgactgcgctcgaacaacacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaagcgctgattcccggcgacgtgcatcag
atccgcctcgcgaacggcgccgtgctgaaggccaggacggtcgtgctcgcgacgggcgcg
cgctggcgcgagatcaacgtgcccggcgaacgcgaataccgcaaccgcggcgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcgtcggcggcggc
aactcgggcgtcgaggccgcgatcgatctcgcgggcatcgtgaaggcagtcacgctgatc
gaatacggcgcgcagctgcgcgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgaccgtcatcaccgaagcgcagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtgtatacggaccgtcgctcgggcgaggtgaagcggatcgaactcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacacggaatggctgaagggcacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgattgcggtcggcgaaggc
gccaaggcgtcgctcggtgcattcgatcatctgatccgccaggacgcgacgccggctgtc
gacacgcaaccgcaagccgacgaagcggtcgccgcctga

DBGET integrated database retrieval system