KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5302Help
Entry
Bmul_5302         CDS       T00624                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABX18972
UniProt: A0A0H3KND4
LinkDB All DBs
Position
2:2452373..2452906
Genome map
AA seq 177 aa AA seqDB search
MVDKAVAEFWQNIAPIANPFKPDALPEAYIPNAASDDERYYVPFTETVSSRPLWISPTQN
KWCDILMAKQAGLVNRHYHPHEVFAYTISGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYEKVGLGAHAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaaagccgtagccgaattctggcaaaacatcgcgccgattgccaatccgttc
aagcccgatgcgctgcccgaggcgtacattccgaacgccgcgtcggacgacgaaagatat
tacgttccgttcaccgaaacggtttcatcgcggccgctgtggatatcgccgacgcagaac
aaatggtgcgacatcctgatggccaaacaggccgggctcgtgaatcgccactatcacccg
catgaagtgttcgcttacacgatctccgggaagtggggctacctcgagcacgagtggacg
gccacgcgcggcgacttcgtgtacgaaacgccgggcgaaggccatacgctcgtcgcgttc
gatcatccggagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgaaggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcgggctcggcgcgcacgcggtcgagaagctgtttcgctga

DBGET integrated database retrieval system