KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5476Help
Entry
Bmul_5476         CDS       T00624                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Bmul_5476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bmu03400]
    Bmul_5476
Enzymes [BR:bmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bmul_5476
DNA repair and recombination proteins [BR:bmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bmul_5476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABX19146
UniProt: A0A0H3KR24
LinkDB All DBs
Position
3:169384..172167
Genome map
AA seq 927 aa AA seqDB search
MAGKLDPYRRKRHFDATPEPEGTRRRRAPADAQPAERGRHPLRYVIQEHHARRLHYDFRL
ELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGEIPAGHYGAGSVIVWDEGTW
TPEGGLAKAREGYRAGKLKFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKERDDDARSAE
AYDVVAQQPGSVHDGATRGHATNGHARARRRGEKAAGKEPDAEADADTDADAPRARATKA
KRPPALSRVEGAVRAPLPERIAPQLATLVDAPPAHGDWRYELKFDGYRMLARIAGKGARR
RVTLMTREGRDWTPKLRALRDALAALEVDDAWLDGEAVVLGENGLPDFQLLQNALGSGQS
DAVTLFVFDLPYLNGYDLRDAPLTARRAQLEPLFDAADPARLRFSPDLGSDAAGLIANAC
DTGLEGLIGKRADARYRAGRSPAWIKLKCRRRQEFVIGGYTEPTGSRHGFGALLLGVHEP
APNGKRTRGASPLRYVGRVGTGFDTRMLDKLAPLLREHERASSPFDPPPQGWSRTRVHWV
EPTLVAECEFAEWTGDGIVRQAAFVALREDKPASQIVREVARHPTTENTMDERTSSSARR
GRAAADTHDGGQDRAQHRAQERAPAARGKSAPDQVGQVRITHPERVLDRESGTRKIDLAH
YWERVAPWALPDLAGRPVSLVRAPQDIGGELFFQKHAERREIPFVTQHPGLDPGHGPLLS
IDSVDALIGAAQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWRTMIEAAQLVRGLL
DELGLVSFCKTSGGKGLHVVVPITRHSGWDEMKDFSRAVAQHIAGALPDRFTATMGPRHR
RGKIFIDYLRNGRGASTIAAYSVRARPGMGVSVPIDWDEVPATTGGAQWTIDTVHERLDA
LERDPWEAYADTRQRITAAMRTRLAAR
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagctcgatccgtatcgccgcaagcgtcatttcgacgcgacgcccgaaccc
gaaggcacgcgccgccgccgcgcgccggccgacgcgcagccggccgagcgcggccggcat
ccgctgcgctacgtgatccaggagcatcatgcgcggcgcctgcattacgatttccggctc
gaactcgacggcacgctgaagtcgtgggccgtgccgaaagggccgagtttcgatccgtcg
gtcaagcggctcgcggtgcacgtcgaggatcatccgctcgaatacgcgtcgttcgaaggc
gagattccggcaggccattacggcgcgggctcggtgatcgtctgggacgagggcacgtgg
acgcccgagggcgggctcgcgaaggcgcgcgaaggctatcgcgccggcaagctgaaattc
cggctcgacggcgagaagctgcacggcggctgggcgctcgtgcgtagcggccgccaggaa
gggcggcaggagcagtggctgctgatcaaggagcgcgacgacgacgcgcgcagcgccgag
gcatacgacgtcgtcgcgcagcagcccggcagcgtgcacgacggcgccacgcgcgggcat
gcgacgaacgggcatgcgcgggcgcgccgacgcggcgagaaggcggccggcaaggagccc
gacgccgaggcggacgccgacaccgacgccgacgcgccacgcgcccgcgcgacgaaagcg
aaacggccgcctgcactgtcgcgcgtcgaaggcgcggtgcgtgcgccgctgccggagcgc
atcgcgccgcaactcgcgacgctcgtcgatgcgccgcccgcgcacggcgactggcgctac
gaactgaagttcgacggctaccggatgctcgcgcgtatcgcgggcaagggcgcgcggcgg
cgcgtgacgctgatgacgcgcgagggccgcgactggacgccgaagctgcgcgcgctgcgc
gatgcgctcgcggcactcgaggtcgacgatgcatggctcgacggcgaagcggtcgtgctc
ggcgagaacgggctgcccgatttccagctgctgcagaacgcgctcggttccgggcagtcg
gatgcggtcacgctgttcgtgttcgatctgccctatctgaacggctatgacctgcgcgat
gcgccgctgacggcacgccgcgcgcaactcgaaccgctgttcgacgccgccgatccggcg
cgcctgcgtttttcgccggatctcggcagcgatgcggccggactgatcgccaacgcgtgc
gacacgggcctcgaagggctgatcggcaagcgcgcggatgcacgctaccgcgcgggacgc
tcgccggcctggatcaagctcaaatgccggcgcaggcaggagttcgtgatcggcggctat
acggagccgaccggtagccgccacggcttcggcgcgctgctgctcggcgtgcacgagccg
gcgccgaacggcaagcgcacgcgcggcgcgtcgccgctgcgctacgtcggccgggtcggc
accggcttcgacacgcggatgctcgacaagctcgcgccgctgctgcgcgagcacgaacgc
gcgtcgtcgccgttcgatccgccgccgcaagggtggtcgcgcacgcgcgtccactgggtc
gagccgacgctcgtcgccgaatgcgaattcgcggaatggaccggcgacggcatcgtgcgg
caggccgcgttcgtggcgctgcgcgaggacaagccggcgtcgcagatcgtcagggaagtc
gcacgccaccccaccacggagaacacgatggacgagcgcacgagctcatccgcgcggcgc
ggccgcgccgcggccgacacgcatgacggcgggcaagatcgcgcgcaacaccgcgcgcag
gaacgcgcgcccgccgcacgcggcaagtcggcgcccgatcaggtcggccaggtccgcatc
acgcatccggagcgcgtgctcgatcgcgagagcggcacgcgcaagatcgatctcgcgcac
tactgggaacgcgtcgcgccgtgggcgttgcccgatctcgcgggccgcccggtgtcgctc
gtgcgtgcgccgcaggacatcggcggcgagctgtttttccagaagcacgcggagcgccgc
gagattccgttcgtcacgcagcatccgggactcgaccccggacacggtccgctactgtcg
atcgacagcgtcgatgcgctgatcggcgccgcgcagatgggcacgatcgagctgcatacg
tggaacgcgcacgcgtcgaacatcgagcggccggaccggatcgtgttcgacctcgatccc
gatccggcgctgccgtggcgcacgatgatcgaggccgcgcagctcgtgcgcgggctgctc
gacgagctgggcctcgtgtcgttctgcaagacgagcggcggcaaggggctgcacgtggtc
gtgccgatcacgcggcattcgggctgggacgagatgaaggacttctcgcgcgcagtcgcg
cagcacatcgcgggcgcgctgcccgaccgcttcacggcgacgatggggccgcgtcaccgg
cgcggcaagattttcatcgactatctgcgcaacggccgcggcgcgagcacgatcgccgcg
tattcggtgcgtgcgcggcccggcatgggcgtgtcggtgccgatcgactgggacgaagtg
ccggccacgacgggcggcgcgcagtggacgatcgacaccgtgcacgaacggctcgacgcg
ctcgagcgcgatccgtgggaagcgtacgcggacacgcgccagcgcatcacggccgcgatg
cgcacgcgcctcgccgcgcgctga

DBGET integrated database retrieval system