KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5490Help
Entry
Bmul_5490         CDS       T00624                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00500  Starch and sucrose metabolism
bmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bmul_5490
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bmul_5490
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bmul_5490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABX19160
UniProt: A0A0H3KR08
LinkDB All DBs
Position
3:complement(189500..192910)
Genome map
AA seq 1136 aa AA seqDB search
MKREDSLDDVRRAQFASHPHAGSPRQRRVRRPAPALCADDPLWYKDAIIYQVHVKSFFDS
NNDGIGDFPGLIAKLDYIAELGVDAIWLLPFYPSPRRDDGYDISDYRDVHPDYGTLADVR
RFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMYRNYYVWSDTDTKYAGTRII
FLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSERD
LLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDEIGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLLN
WTRRILATRRATQVFGRGSIRFLRPENRKVLAYLRELEGHDPVLCVANLSRASQAVELDL
SEFAGRVPIEMTSDSPFPPVGQLPYLLTFPPYGFLWFVLSAHGREPAWRQPHAEPLPEYV
TLVMRRGDTRPDVAQLHTLAHDALASWLTRRRWFASKDRTIADARLNVVTPIPGESFQYA
EACVTVRGDSHAERYVVPLAVAWGGETSGPLFAQLALARVRRGHTVGYLTDAFALPAFAH
GMLRKLRAGATVPTSDGGHLAFLPEAALASLDPGDEAEVRWLAAEQSNSSLVIGEAIVLK
LVRKVAHGVHPEAEMSRHLTRIGYQNTAALAGEVVHVDPDGRPHTVAILQRFVDNQGDAW
TRSFDFLKRAVDELALPAADDVDTVEPDAETDALLGYAAFAGVVGKRLGELHVALAQPSD
DPAFAPERATPEHVDGWCADAIASFEQALDCLGTRLDALDADTRAAAERLLASRDAAVRA
LGELVPRTLDAHCTRIHGDFHLGQVLDVQGDALLIDFEGEPARALERRRAKSHPLRDVAG
FLRSLSYVSATGQFAIEKAPPQAADRKRALFERFGRAAADAFVDCYRAAAEHAPVRFVDP
RYTDRLLALFLIDKASYELCYEAANRPDWLCVPVGGLAALVERLLEHRGAEDGDES
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagattccctcgacgacgtgcggcgcgcgcagttcgcgtcgcatccgcac
gccggctcgccgcgccagcgccgcgtgcgccggcccgcgcccgcgctctgcgccgacgat
ccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttcttcgactcg
aacaacgacggcatcggcgacttccccggcctgatcgcgaagctcgactacatcgcggaa
ctcggcgtcgacgcgatctggctgctgccgttctatccgtcgccgcgccgcgacgacggc
tacgacatctccgactatcgcgacgtgcatcccgactacggcacgctcgccgacgtgcgc
cgcttcatccgcgaagcgcatgcgcgcggcattcgcgtgatcaccgagctcgtgatcaac
catacgtcggaccagcatccgtggttccagcgcgcgcggcgcgccaagccgggctcgatg
taccgcaactactacgtgtggtccgacaccgacacgaagtacgccggcacgcgcatcatc
tttctcgacaccgagacgtcgaactggacgcacgatccggtcgcgggccagtactactgg
catcgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgcgaa
gtgctgcaggtcatgcgcttctggctcgacctcggcatcgacgggctgcgcctcgacgcg
gtgccgtatctcgtcgagcgcgaaggcacgaacaacgagaacctgccggagacgcacgcg
atcctgaagcggatccgcgcgacgatcgacgccgagtatccgaaccgcatgctgctcgcc
gaagcgaaccagtggccggaggacgtgcaggaatacttcggcaacgaggacgaatgccac
atggcgttccactttccgctgatgccgcgcatctacatgtcgatcgcgagcgaggaccgc
tttccgatcatcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgggcc
gtgttcctgcgcaatcacgacgagctcacgctcgagatggtcaccgattccgagcgcgac
ctgctctggcagacctacgcgagcgaccgccgcgcgcggctgaacctcgggatccggcgc
cggctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaactcgctgctg
ctgtccatgcccggcacgcccgtcatctactacggcgacgagatcggcatgggcgacaac
atccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggaccgcaac
ggcggcttctcgcgcgccgacccggaactgctcgtgctgccgcccgtcatgggctcgctg
tacggctatgacgcgatcaacgtcgaagcgcagacgcgcgacccgcactcgctgctgaac
tggacgcggcgcatcctcgcgacgcggcgcgcgacgcaggtgttcgggcgcggctcgatc
cgcttcctgcgtccggagaaccgcaaggtgctcgcctatctgcgcgaactcgaggggcac
gacccggtgctctgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgaactcgacctg
tccgaattcgcgggccgcgtgccgatcgagatgacctcggactcgccgttcccgcccgtc
ggccagctcccgtatctgctcacctttccgccgtacggcttcctctggttcgtgctgtcc
gcgcacggccgcgagcccgcctggcggcagccgcatgcggaaccgctgcccgaatacgtg
acgctcgtgatgcggcgcggcgacacgcggcccgacgtcgcgcagctgcacacgctcgcg
cacgacgcgctcgcgtcgtggctcacgcggcggcgctggttcgcgtcgaaggaccgcacc
atcgccgacgcgcgcctgaacgtcgtcacgccgattccgggcgaatcgttccagtacgcc
gaagcctgcgtgacggtgcgcggcgacagccacgccgagcgctacgtggtgccgctcgcg
gtcgcgtggggcggcgagacctccggcccgctgttcgcgcagctcgcgctcgcgcgcgtg
cggcgcggccatacggtcggctatctgaccgacgcgttcgcgctgcccgccttcgcgcac
ggcatgctgcgcaagctgcgcgcgggcgcgacggtgccgacgtccgacggcggccatctc
gcgttcctgcccgaggccgcgctcgcgtcgctcgaccccggcgacgaggccgaagtgcgc
tggctcgcggccgagcagagcaacagctcgctcgtgatcggcgaagcgatcgtgctgaag
ctcgtgcgcaaggtcgcgcacggcgtgcatcccgaagcggagatgagccggcatctgacg
cgcatcggctaccagaacaccgccgcgctcgccggcgaagtcgtgcacgtcgatccggac
gggcgcccgcatacggtcgcgatcctgcagcgcttcgtcgacaaccagggcgatgcgtgg
acgcgttcgttcgacttcctgaagcgcgccgtcgacgagctcgcgctgccggccgccgac
gacgtcgacaccgtcgaaccggacgccgagacggacgcgctgctcggctatgcggcgttc
gccggtgtcgtcggcaagcggctcggcgagctgcacgtcgcgctcgcgcagccgtccgac
gatccggcgttcgcgcccgagcgcgcgacgcccgagcacgtcgacggctggtgcgccgac
gcgatcgcgtcgttcgagcaggcgctcgactgtctcggcacgcggctcgatgcactcgac
gccgacacgcgcgcggccgccgaacggctgctcgcgtcgcgcgacgcggccgtgcgcgcg
ctcggcgaactcgtgccgcgcacgctcgatgcgcactgcacgcgcattcacggcgacttc
catctcgggcaggtgctcgacgtgcagggcgacgcgctgctgatcgatttcgaaggcgag
cccgcgcgcgcgctcgagcggcgccgcgcgaagtcgcacccgctgcgcgatgtggccggc
ttcctgcgctcgctgtcgtacgtgagcgcgaccgggcagttcgcgatcgagaaagcgccg
ccgcaggcggccgaccgcaagcgtgcactgttcgagcgcttcggccgcgcggccgccgac
gcgttcgtcgactgctatcgcgcagccgccgagcatgcgccggtgcgcttcgtcgatccg
cgctacaccgaccggctgctcgcgctgttcctcatcgacaaggcgtcgtacgagctctgc
tacgaggccgcgaaccgtcccgactggctctgcgtgccggtcggcggcctcgcggcgctc
gtcgagcggctgctcgaacatcgcggcgccgaagacggagacgagtcatga

DBGET integrated database retrieval system