KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5498Help
Entry
Bmul_5498         CDS       T00624                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00020  Citrate cycle (TCA cycle)
bmu00190  Oxidative phosphorylation
bmu00650  Butanoate metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
Module
bmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bmul_5498
   00650 Butanoate metabolism
    Bmul_5498
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bmul_5498
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bmul_5498
    1.3.5.4  fumarate reductase (quinol)
     Bmul_5498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: ABX19168
UniProt: A0A0H3KRT4
LinkDB All DBs
Position
3:201568..202278
Genome map
AA seq 236 aa AA seqDB search
MDDDTRILHIYRYDPDRDAAPYMQRYEITVQPDDRMLLDVLGRLKREDETLSYRRSCREG
ICGSDAMNINGSNGLACLTNMKTLPREITLRPLPGLPVVRDLIVDMTDFFNQYHSIKPYL
INDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPTFWWNPDKFVGPAGLLQAYRFI
ADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPARAISNIRAMLVRRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgacacgcgcatcctccatatctatcgctacgaccccgatcgggacgcggcg
ccttacatgcagcgttacgagatcaccgtgcagcccgacgaccggatgctgctcgacgtg
ctcgggcgcctgaagcgcgaagacgagacgctctcgtatcgccgttcgtgccgcgaaggg
atctgcggctccgatgcgatgaacatcaacggctcgaacgggctcgcatgcctgaccaac
atgaagacgctgccgcgcgaaatcacgctgcgcccgctgccggggctgccggtcgtgcgc
gacctgatcgtcgacatgaccgattttttcaatcagtaccactcgatcaagccgtatctg
atcaacgacacgccgccgcccgagcgtgagcggctgcagtcgcctgccgagcgcgatcag
ctcgacgggctgtacgaatgcatcctctgcgcgtgctgctcgacgcagtgtccgacgttc
tggtggaatccggacaagttcgtcgggccggccgggttgctgcaggcctaccgcttcatt
gccgattcgcgtgatctcgcgaccggcgagcggctcgacaacctcgaggatccgtatcgg
ctgttccgctgccggacgatcatgaactgcacgagcgtgtgtccgaaggggctgaatccg
gcgcgcgcgatctcgaacattcgcgcgatgctggtgcggcgcgcggtgtag

DBGET integrated database retrieval system