KEGG   Burkholderia multivorans ATCC BAA-247: NP80_3066Help
Entry
NP80_3066         CDS       T03881                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NP80_3066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmul02000]
    NP80_3066
Enzymes [BR:bmul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NP80_3066
Transporters [BR:bmul02000]
 Other Transporters
  Pores ion channels [TC:1]
   NP80_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJY17676
LinkDB All DBs
Position
1:3278529..3279143
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGAVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP
FAESGAVLLYLADRCPGAGLGIAPDDPERGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA
FGWGNITRVQRALAQTLAHSRWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDGYRRAVAVEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaaaacccgggcgttccgggcgttgtggatgctggaggaa
atcggcgccgtctacgagctggtgccgatcgacctgcgctcgcacgaacagggcagcgac
gcgttcgtgcaggtgaatccgatggcgaaactgcccgcgctcgacgacggcagcgcgccg
ttcgccgaatcgggcgcggtgctgctctatcttgccgatcgctgcccgggcgcgggcctc
ggcatcgcgccggacgacccggagcgcggccgcttcctgcagtggatgttcttcacgccc
acctgtctcgagccggccatggcggaaaaattcaccggcgcgtcgggcaacccggtcgcg
ttcggctggggcaacatcacgcgcgtgcagcgcgcgctcgcgcagacgctcgcgcatagc
cgatggctcgtcggcgaccgcttcaccgccgccgatctgctgctcgcgagcacgctgaag
atcgccttcgacgcgcatctgctgccgcacgaaggtgtgctcggcgactacgtcgcgcgc
gccgaggaccgcgacggataccgtcgcgcggtcgcggtcgagcagcgcgaagcggcgcgg
ctgctgcacgcgtaa

DBGET integrated database retrieval system