KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4123Help
Entry
NP80_4123         CDS       T03881                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NP80_4123 (ahpF)
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NP80_4123 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin Ribosomal_S9 K_oxygenase FAD_oxidored Thi4 AlaDh_PNT_C FMO-like DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJY15686
LinkDB All DBs
Position
2:complement(1045102..1046700)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLEKITRPIELVASLDDSAKSQELRALLDEIASLTTRVTVIERRDDEA
RTPSFSIGEPGQPARIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKARTVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTVITEAQTTELTGDGSKL
NGLVYTDRRSGEVKKIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPAVAAQPQADEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagacccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcatcgctcgacgacagcgcgaagtcgcaggaactgcgtgcgctgctc
gacgagattgcatcgctgacgacgcgcgtcaccgtgatcgaacgccgcgacgacgaggcg
cgcacgccgtcgttctcgatcggcgaaccgggccagcccgcgcggatccgcttcgctggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcc
ttcgagacgtacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaatccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgaagcacgccagatcatggcggtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaaactcgatacgggcgccggc
gcacgcgcggcaaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgccgcggccgcgatctactccgcgcgcaagggcatcgcgaccggcgtg
gtcgccgaacgtttcggcggccaggtactcgacacgatggcgatcgagaatttcgtgtcg
gtgcaggaaaccgaaggaccgaagttcgcgactgcgctcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaagcgctgattcccggcgacgtgcatcag
atccgcctcgcgaacggcgccgtgctgaaggccaggacggtcgtgcttgcgacgggcgcg
cgctggcgcgagatcggcgtgcccggcgaacgcgaataccgcaaccgcggcgttgcatac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatcggcggcggc
aactcgggcgtcgaggccgcgatcgatctcgcgggcatcgtgaaggcagtcacgctgatc
gaatacggcgcgcagctgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtaaccgtcatcaccgaagcgcaaacgaccgagctcaccggcgacggcagcaagctg
aatgggctcgtgtatacggaccgtcgctcgggcgaagtgaagaagatcgaactcgaaggc
gtgttcgtgcagatcggactcgttccgaacaccgaatggctgaagggcacagtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gccaaggcgtcgctcggcgcgttcgatcatctgatccgccaggacgcgacgccggctgtc
gccgcgcagccgcaagccgacgaagcggtcgccgcctga

DBGET integrated database retrieval system