KEGG   Burkholderia multivorans ATCC BAA-247: NP80_5182Help
Entry
NP80_5182         CDS       T03881                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00250  Alanine, aspartate and glutamate metabolism
bmul00410  beta-Alanine metabolism
bmul00650  Butanoate metabolism
bmul01100  Metabolic pathways
bmul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NP80_5182 (gabT)
   00650 Butanoate metabolism
    NP80_5182 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NP80_5182 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NP80_5182 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmul01007]
    NP80_5182 (gabT)
Enzymes [BR:bmul01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NP80_5182 (gabT)
Amino acid related enzymes [BR:bmul01007]
 Aminotransferase (transaminase)
  Class III
   NP80_5182 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJY16241
LinkDB All DBs
Position
2:2308400..2309683
Genome map
AA seq 427 aa AA seqDB search
MKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAEQLDLFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLNALQAEVPQIADVRGPGAMIAVEFMK
PGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALAILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgctggcccgcaagaacgccgcgaccccgcgcggcgtcggagtg
atgtgcgacttctacgccgcccgcgccgagaacgcggagctgtgggacgtcgaaggccgc
cgtttcatcgatttcgccgcgggcatcgcggtgctgaacacgggccatcgtcatccgaag
atcgtcaaggcgatcgcggagcagctggacctcttcacgcacaccgcctaccagatcgtg
ccgtacgcgtcgtacgtcgagctggccgaaaagatcaacgaacgcgcgccgggcgacttc
ccgaaaaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcacgcgcggcaaccggccgtccgggcgtgatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggtccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacgaccgcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgagttc
gtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtggtcggc
cgtgcggacgtgatggacgcggccgcgccgggcggcctcggcggcacgtatgcgggcaac
ccgctcgcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagaaaagctgtgc
gagcgcgcgacgcagctcggcgacacgctgaaggcgaagctgaacgcgctgcaggccgag
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcatgaag
ccgggcaccggcgagccggacgccgaattcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgcgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system