KEGG   Burkholderia multivorans ATCC BAA-247: NP80_5567Help
Entry
NP80_5567         CDS       T03881                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00020  Citrate cycle (TCA cycle)
bmul00190  Oxidative phosphorylation
bmul00650  Butanoate metabolism
bmul01100  Metabolic pathways
bmul01110  Biosynthesis of secondary metabolites
bmul01120  Microbial metabolism in diverse environments
bmul01130  Biosynthesis of antibiotics
bmul01200  Carbon metabolism
Module
bmul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmul_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NP80_5567
   00650 Butanoate metabolism
    NP80_5567
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NP80_5567
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NP80_5567
    1.3.5.4  fumarate reductase (quinol)
     NP80_5567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AJY14977
LinkDB All DBs
Position
3:388212..388922
Genome map
AA seq 236 aa AA seqDB search
MDDDTRILHIYRYDPDRDAAPYMQRYEIAVQPDDRMLLDVLGRLKREDETLSYRRSCREG
ICGSDAMNINGSNGLACLTNMKTLPREITLRPLPGLPVVRDLIVDMTDFFNQYHSIKPYL
INDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPTFWWNPDKFVGPAGLLQAYRFI
ADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPARAISNIRAMLVRRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgacacgcgcatcctccatatctatcgctacgaccccgatcgggacgcggcg
ccttacatgcagcgctacgagatcgccgtgcagcccgacgaccggatgctgctcgacgtg
ctcgggcgcctcaagcgcgaagacgagacgctctcgtatcgacgctcgtgccgcgaaggg
atctgcggctccgatgcgatgaacatcaacgggtcgaacgggctcgcgtgcctgaccaac
atgaagacgctgccgcgcgagatcacgctgcgcccgctgccgggcctgccggtcgtgcgc
gacctgatcgtcgacatgaccgactttttcaatcaataccactcgatcaagccgtatctg
atcaacgatacgccgccgcccgagcgcgagcgcctgcagtcgccggccgagcgcgaccag
ctcgacgggctgtacgaatgcatcctctgcgcgtgctgttcgacgcagtgtccgacgttc
tggtggaatccggacaagttcgtcgggccggccgggttgctccaggcgtaccggttcatc
gccgattcgcgcgatctcgcgacgggcgagcggctcgataacctcgaggatccgtatcgg
ctgttccgctgccggaccatcatgaactgcacgagcgtgtgcccgaaggggttgaatccg
gcgcgcgcgatctcgaacattcgggcgatgctggtgcggcgcgcggtgtaa

DBGET integrated database retrieval system