KEGG   Burkholderia multivorans ATCC BAA-247: NP80_994
Entry
NP80_994          CDS       T03881                                 

Definition
(GenBank) hypothetical protein
Organism
bmul  Burkholderia multivorans ATCC BAA-247
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: AJY18726
LinkDB
Position
1:1056003..1057520
AA seq 505 aa
MTLNTTDYLEYYLTLVGWIVSNGIWSILVASGVFALPFVVMVVQEWLRARAEGADEGNKG
VLSSMRIENRVWVAIVVILFAGIPFIPVDLSTIKFDTTRSAQCQVSVPQPTDTGWSNAYT
TLNNQSALVPVWWFFMHAISKAVTGGAVAAIPCGTDLRQMRMDVDATRIDDPVLAQEVGD
FVHDCYGPSRAKLFMSRPTLSDEQMNDVTWIGSSYFLNNAGFYDTYHSNTPRTAWPYDAT
RDAGLAQVDSGGGYPTCRQWWSDGGSGLRARLLAQVDPDLLTRIGRWAGFLSQSEVNDSV
IRAVVSPRQQKMNQGSVYTDYGGQIEKTLPNVVTRGAGDLGLTMGSLGFFPAMDVVRQAL
PMVLSLLKMALVICIPLVLVFGTYELKALVAVSCVQFALFFVDFWFQLARWLDSTILDAL
YGWGFGANRPHSNFDPLIGLNNAFGDMLLNFVMATMFIVLPTFWVAALGWVGVRAGTAIQ
GLAAGTRDAQAAGGRGAGVAMKAAK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgacgctcaacacaacggactacctggagtattacctgaccctggtcgggtggatcgtc
agcaacggcatctggagcatcctcgtggccagcggcgtgttcgcgctgccgttcgtggtc
atggtggtgcaggaatggctgcgcgcgcgggccgaaggcgcggacgagggcaacaagggc
gtgctgtcctcgatgcgcatcgagaaccgcgtgtgggtggcgatcgtcgtcatcctgttc
gccggcatccccttcattccggtcgacctcagcaccatcaagttcgacacgacgcgctcc
gcgcaatgccaggtcagcgtcccgcagcccaccgacacgggctggtcgaacgcctacacc
acgctcaacaaccagagcgcgctggtgccggtgtggtggttcttcatgcacgccatctcg
aaggcggtgacgggcggcgcggtggcggcgatcccctgcgggacggatctgcgtcagatg
cgcatggacgtggatgccacgcgcatcgatgacccggtgctggcccaggaggtcggcgac
ttcgtgcatgactgctacggcccctcgcgcgccaagctgttcatgtctcggcccacgctc
tccgacgagcagatgaacgacgtgacctggatcggttcgagctacttcctgaacaacgcg
ggcttctacgacacctaccactccaacacgccacgcacggcttggccctacgacgcgacg
cgcgatgcagggctggcccaggtggatagcggcgggggctaccccacgtgccggcagtgg
tggtcggacggcggcagcggcctgcgcgcgcgcctgctggcccaggtcgatcccgacctg
ctgacgcgcatcggccgctgggcgggcttcctgtcgcagagcgaggtaaacgactcggtg
atccgcgccgtggtctcgccgcggcagcagaagatgaaccagggctcggtctacaccgac
tacggcgggcagatcgagaagacgctgcccaacgtcgtgacgcgcggcgccggcgacctc
gggctgaccatgggctcgctgggcttcttcccggcgatggacgtggtgcgccaggcgctg
ccgatggtgctgtcgctgctcaagatggcgctggtgatctgcatcccgctggtgctggtc
ttcggcacctatgagctgaaggcgctggtcgcggtgagctgcgtgcagttcgcgctgttc
ttcgtggacttctggttccagctcgcgcgctggctggacagcacgatcctcgacgcgctc
tatggctgggggttcggcgcgaaccggccgcacagcaacttcgatccgctgatcggcctg
aacaacgccttcggagacatgctgctgaacttcgtcatggcgacgatgttcatcgtgctg
cctaccttctgggtggctgcgctgggctgggtaggcgtgcgcgccggaacggcaattcaa
gggctggcggcaggaaccagggacgcccaagctgctggcggcaggggtgcgggtgtcgct
atgaaagcagcgaagtaa

DBGET integrated database retrieval system