KEGG   Bacillus muralis: ABE28_000575Help
Entry
ABE28_000575      CDS       T05340                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bmur  Bacillus muralis
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bmur03012]
    ABE28_000575
   03029 Mitochondrial biogenesis [BR:bmur03029]
    ABE28_000575
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmur04147]
    ABE28_000575
Translation factors [BR:bmur03012]
 Eukaryotic Type
  Elongation factors
   ABE28_000575
 Prokaryotic Type
   ABE28_000575
Mitochondrial biogenesis [BR:bmur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ABE28_000575
Exosome [BR:bmur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ABE28_000575
  Exosomal proteins of breast cancer cells
   ABE28_000575
  Exosomal proteins of colorectal cancer cells
   ABE28_000575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AOH52862
UniProt: A0A1B3XI11
LinkDB All DBs
Position
115451..116638
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKPHVNVGTIGHVDHGKTTLTAAITTVLAKSGGAEARAYDQIDGAPEERERG
ITISTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEIRDLLTEYDFPGDDIPVIKGSALKALQ
GDAAWEEKIHELMNAVDEYIPEPTRDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
DVVDIIGFNEESKPTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREDIQRGQVLAKPGTI
TPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGICNLPEGVEMVMPGDNIEM
TVELIAPIAIEEGTKFSIREGGRTVGAGVVATITE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagctaaatttgatcgttcaaaaccgcacgttaacgttggaacaattggtcac
gttgaccatggtaaaacaactctaacagctgcaatcacaactgtacttgctaaatctggt
ggcgctgaagcacgcgcttatgaccaaatcgatggtgctccagaagaaagagaacgtggt
atcacaatctctactgcacacgttgagtacgaaacagctactcgtcactatgcacacgtt
gactgcccaggacatgctgactatgttaaaaacatgatcactggtgctgcacaaatggac
ggcggaatcctagtagtatctgctgctgatggcccgatgcctcaaacgcgtgagcacatc
cttctttcacgtcaagtaggtgtaccatacctagtagtattcatgaacaaatgcgacatg
gttgatgacgaggaacttcttgaattagtagaaatggaaatccgtgatcttctaactgaa
tacgatttccctggcgatgacattccagttatcaaaggttctgcactaaaagctcttcaa
ggagacgctgcttgggaagaaaaaattcatgaattgatgaacgctgttgacgagtacatc
ccagaaccaactcgtgacactgaaaaaccattcatgatgccagttgaggatgtattctca
atcactggtcgtggaactgttgctactggtcgtgttgagcgtggacaagttaaagtcggt
gacgttgttgacatcatcggtttcaacgaagagtctaaaccaacaactgtaactggagtt
gaaatgttccgtaaacttcttgactatgctgaagctggtgacaacatcggtgcacttctt
cgtggtgtatcccgtgaagatatccaacgtggacaagtgcttgctaaaccaggtacaatc
actccgcacactaagttcaaagctgaagtttatgttctttctaaagaagaaggtggacgt
cacactccattcttcacaaactaccgtcctcagttctacttccgtacaaccgatgtaact
ggtatttgtaaccttcctgaaggcgtagaaatggttatgcctggagacaacatcgaaatg
actgtagaacttatcgctccaatcgctatcgaagaaggtactaaattctctatccgtgag
ggtggacgtactgtaggcgctggtgtagttgctacaatcactgagtaa

DBGET integrated database retrieval system