KEGG   Bacillus muralis: ABE28_001340Help
Entry
ABE28_001340      CDS       T05340                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmur  Bacillus muralis
Pathway
bmur00473  D-Alanine metabolism
bmur00550  Peptidoglycan biosynthesis
bmur01100  Metabolic pathways
bmur01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE28_001340
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABE28_001340
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ABE28_001340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmur01011]
    ABE28_001340
Enzymes [BR:bmur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABE28_001340
Peptidoglycan biosynthesis and degradation proteins [BR:bmur01011]
 Precursor biosynthesis
  Amino acid ligase
   ABE28_001340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AOH52998
UniProt: A0A1B3XIG2
LinkDB All DBs
Position
272779..273861
Genome map
AA seq 360 aa AA seqDB search
MKTKLGLLYGGKSAEHDVSMQTALAVIKALDLAKFDIYPIYITKDGSWINGPKLTAPPED
VAALTFLPEKSTSPLALQAHSTDENGESTGYDVIFPLLHGPNGEDGTVQGMLELLNLPYV
GNGVLASSAGMDKVIMKNIFAHAGLPQVKYTWFIRSEWEANKEAGIKKVEDEIGYPCFVK
PANLGSSVGISKCDDSHSLEKAVAEAFQFDRKIIIEEGVVAREVEFGILGNDDPTCSVAG
EIIPKKDFAFYDYSAKYEDGNSAMVIPAEISENEFAALSAMAISAFKSLDCSGLVRADFF
LTKEGKIFINEVNTMPGFTPYSMFPLLWKHTGVDYPALIEKLVKLALERHREKQQIKYTV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaacttggtttgctttatggtgggaaatctgcggagcatgatgtttcaatg
cagacggctttagctgtcatcaaagcactcgatttagcaaagtttgatatatatccgatt
tacataacaaaagatggttcgtggataaatggcccgaaattaaccgcacctccagaggat
gtagcggctttgacttttttgcctgaaaaatcgacctcaccgcttgcgctgcaagcccat
tcaactgatgaaaatggtgaatcgactggatatgacgtcattttcccgttgcttcatgga
cctaatggagaggacggaacggttcaagggatgctggaactgctgaaccttccttatgta
ggcaatggcgttctagcgtcatcggctggaatggataaggttatcatgaaaaacatcttt
gctcatgctggacttcctcaagtgaaatacacatggttcattcgctctgaatgggaagcc
aataaggaagctgggattaaaaaggttgaagatgaaattgggtacccttgctttgttaaa
ccggcgaacctaggttccagtgtcggcattagtaaatgtgatgattcacatagcttggaa
aaagcggtcgcggaggctttccaatttgaccggaaaatcatcattgaagaaggggtcgta
gcacgggaagtggagtttggcattctaggcaatgatgatcctacttgctcagtggcggga
gagatcatccccaaaaaggatttcgccttctatgattactcagcaaaatacgaggatggg
aattccgcaatggtcatcccagctgaaattagtgaaaatgagtttgccgcgttatccgca
atggccatctctgcctttaagtcattggattgctctggattggtcagagccgatttcttc
ttgacgaaagaggggaaaatttttatcaatgaagtgaatacaatgcctgggttcactcct
tatagcatgttccctctactctggaagcacacaggagtcgactatccggctttgattgaa
aaactcgtcaagcttgctttggaacgtcatcgtgaaaaacagcaaataaaatatacagtc
taa

DBGET integrated database retrieval system