KEGG   Bacillus muralis: ABE28_001385Help
Entry
ABE28_001385      CDS       T05340                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmur  Bacillus muralis
Pathway
bmur00473  D-Alanine metabolism
bmur01100  Metabolic pathways
bmur01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE28_001385
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ABE28_001385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmur01011]
    ABE28_001385
Enzymes [BR:bmur01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABE28_001385
Peptidoglycan biosynthesis and degradation proteins [BR:bmur01011]
 Precursor biosynthesis
  Racemase
   ABE28_001385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOH53007
UniProt: A0A1B3XIG0
LinkDB All DBs
Position
284105..285262
Genome map
AA seq 385 aa AA seqDB search
METKIFHRDTWAEVNLDHIYKNISSMKTRLRNDVSLFAVVKANAYGHGDYDVAKTALEAG
ADFLSVAFLDEALSLRKKGITAPILVLGASRPESAALAAEQGISVTAFDEAWLESAKAQL
KPGQVLQVHVKVDSGMGRIGIRDKSQLMKVEGLLMREPCFNFQGIFTHFATADELKTDLY
EKQLAVFKAMLAELTERPEYIHAANSAASLRFADPIWNAVRMGISMYGLSPSMEMKPLLP
FPLQQSISLKTKLVAVKQLVEGESVSYGATYTAQGKEWIGTLPIGYADGWIRKLQGQEVL
IEGMRVPIVGRICMDQCMIKLPRSFPVGTEVTLIGDDGVESITVDEIAAKLETINYEVTC
MIGARVPRVYIKDNQKKHIRNFILE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaaaatatttcatcgagatacgtgggcagaagtgaatttggaccatatttat
aaaaatatttcttcaatgaaaacaagactaagaaatgacgttagcctttttgctgtcgtc
aaagcgaatgcttatggccacggcgattatgatgtggcgaaaacggcgcttgaagcgggg
gctgattttttaagcgtagccttcttggatgaggctctgtctttacgaaaaaaagggatt
acggcgcccatcttggttctaggggcctccaggcctgaaagtgcagcgcttgccgcagag
caagggatttccgtgacagcttttgatgaagcttggctggaaagcgcaaaggctcagctt
aaaccgggacaagtcctgcaagttcatgtgaaagtggatagcggtatggggagaattggt
atacgcgataaaagccagctgatgaaagtggaaggtttgttaatgcgggaaccatgcttt
aactttcaagggatattcactcatttcgcaacggcagacgaactgaagacagatctctat
gaaaaacagcttgctgtatttaaagcgatgcttgctgagttgacggaacggccggaatat
atccatgctgcgaatagtgcagcatctctaaggtttgccgatccaatatggaatgcggtt
aggatgggaatttccatgtacggattaagcccttcgatggaaatgaagccgttattgcca
ttcccattacaacagtccatctcattaaaaacgaagttggtcgcggttaaacagcttgtg
gaaggtgaaagtgtaagttacggcgcgacctatacggcacaaggaaaagaatggatcgga
accttgccgattggttatgctgacgggtggattcgcaagcttcaaggtcaggaagtgctt
atagaaggtatgagggtgccgattgtcggccggatttgcatggatcagtgcatgatcaag
ctcccaaggtcattccctgttgggacagaggttacactcataggcgatgacggggttgaa
tcgatcaccgtggatgagatagcggccaaactggaaacgatcaattatgaggtgacctgt
atgataggagcaagggtgcctcgcgtatatataaaagataatcagaaaaaacatatccgc
aacttcatcttggaatga

DBGET integrated database retrieval system