KEGG   Bacillus muralis: ABE28_002655Help
Entry
ABE28_002655      CDS       T05340                                 

Definition
(GenBank) hypothetical protein
  KO
K07228  TrkA domain protein
Organism
bmur  Bacillus muralis
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ABE28_002655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-ProteinID: AOH53237
UniProt: A0A1B3XJ65
LinkDB All DBs
Position
complement(561615..562112)
Genome map
AA seq 165 aa AA seqDB search
MKIRESELPGIGQKFEIITRNDEKLVVVIHDDGRRELYHFDQEHEDVISSITINDQESRQ
LASIIGGMVYKPQALETIEMSLGDLVIEWFKVEPGSKAINQTIGSIDIRSNYNVTVIAHS
KKGKKQLNNPGPDSIIETGDTLVISGERKDIRNLTRELLTDERSD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattagagaaagtgaacttcctggtattggccaaaagttcgaaatcataaccaga
aatgatgaaaagctagtagtcgtcattcacgatgacggccggcgggaattataccatttt
gatcaagagcacgaggatgtcatttcaagcattaccattaacgatcaggaatcaaggcaa
ttggcttccatcattggcggcatggtttataaaccacaagcccttgaaacgattgaaatg
tccctgggtgacctggtgattgaatggttcaaggtggaaccgggctcaaaagccatcaat
caaacgattggttcgattgatatccggagcaattataacgttaccgtcatcgcccattcg
aaaaagggtaaaaaacaactgaataatcccggtcctgactccatcatcgaaacaggcgat
acactggtgatatctggtgaaagaaaagatatccgtaacctgacaagagaattattgacc
gacgaaaggagtgactaa

DBGET integrated database retrieval system