KEGG   Bacillus muralis: ABE28_005845Help
Entry
ABE28_005845      CDS       T05340                                 

Definition
(GenBank) transcriptional regulator
  KO
K02250  competence protein ComK
Organism
bmur  Bacillus muralis
Pathway
bmur02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ABE28_005845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmur03000]
    ABE28_005845
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmur02044]
    ABE28_005845
Transcription factors [BR:bmur03000]
 Prokaryotic type
  Other transcription factors
   Others
    ABE28_005845
Secretion system [BR:bmur02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   ABE28_005845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AOH53865
UniProt: A0A1B3XKW6
LinkDB All DBs
Position
1221559..1222119
Genome map
AA seq 186 aa AA seqDB search
MQNNQGIIEEYEITPHTLMVAPLNYGSKIYARIIEMEDEFISPFKPLEIIKKSCEFFGSS
YEGRRQGTRQLINITHKAPIAIDPTSSIFFFPTTSPLRPQCIWLSHEHVVAYDRLDPKHT
TVTFRNKQTIDMEVSYSSFENQLHRTSFLKTKLIQRIEETKRKSFYLFNDASGAKASEVM
SKYLPR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaaccagggaattattgaggaatatgaaattacgccccatacacttatggtt
gcaccgcttaactatggcagtaaaatctatgcccgtatcatagaaatggaagacgagttc
atatcaccgttcaaacctttggaaattatcaagaaaagctgtgagttctttgggtcgagt
tacgaaggtcgcagacaaggaacacggcagctcataaacatcacacataaagcgccaatc
gcgatcgatccgaccagttcgatttttttctttccaactacatccccgctccggcctcaa
tgcatctggttatcacatgagcatgttgttgcctatgatcgcctggatcccaaacatacg
accgtcacattcaggaataaacaaaccatcgatatggaggtatcatacagctcgttcgaa
aatcagctgcaccggacatcctttttaaaaacgaaactgattcaaaggattgaggaaaca
aagaggaagtctttctatttattcaacgatgcaagtggagccaaggcttcagaggtaatg
tcaaaatatttaccgcgttag

DBGET integrated database retrieval system