KEGG   Bacillus muralis: ABE28_006220Help
Entry
ABE28_006220      CDS       T05340                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bmur  Bacillus muralis
Pathway
bmur00061  Fatty acid biosynthesis
bmur00780  Biotin metabolism
bmur01100  Metabolic pathways
bmur01130  Biosynthesis of antibiotics
bmur01212  Fatty acid metabolism
Module
bmur_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABE28_006220
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABE28_006220
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ABE28_006220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmur01004]
    ABE28_006220
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ABE28_006220
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ABE28_006220
Lipid biosynthesis proteins [BR:bmur01004]
 Fatty acid synthase
  Component type
   ABE28_006220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AOH53940
UniProt: A0A1B3XL62
LinkDB All DBs
Position
1300483..1301256
Genome map
AA seq 257 aa AA seqDB search
MTFSLEGKTFVIMGVANKRSIAWGVARSLHKAGAKLIFTYGKDRTEKSIIELSSTLDGEP
SIILQCDVTKDEAIEECFATIKEKVGIIHGVAHSVAFANKEELDGEFVNTSREGFLLAHN
ISSFSLTAVAKAAKELMPEGGSIVTMTYLGGERVMPNYNVMGVAKASLEANVRYLSSDLG
KDNIRVNAISAGPIRTLSAKGVRDFNSILKKIEEEAPLRRTTTPEEVGDTALFLLSDMSR
GITGENIHVDSGYHIMG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactttttcactagaaggaaaaacgtttgtcataatgggtgtagcgaataaaagaagt
atagcttggggagttgcccgttccttacataaagcaggtgcaaaactgatattcacgtat
ggtaaagatcgtacggaaaaaagcataattgaactatcctccacgttggacggcgagcct
tccatcatcttgcaatgcgatgtaactaaggacgaggcaatcgaggaatgctttgcaacc
attaaggaaaaggtaggcatcatccacggtgttgcccattccgtcgcttttgcgaacaag
gaagaacttgatggagagttcgtcaacacaagccgtgaaggattcttgcttgcccacaat
atcagttctttctctttaacggctgtggccaaagcagcgaaggaacttatgcctgaaggt
ggcagcatcgtcacgatgacgtatcttggcggagaacgcgtcatgccgaattataatgtg
atgggtgtggcaaaggcttcgcttgaagcaaatgtccgttatctgtccagcgaccttggc
aaagataacatccgggtgaacgccatttcagcaggaccgatacgtacgttatcggcaaaa
ggagtccgcgatttcaatagtatcctgaagaagattgaggaagaggcacctcttcgccgc
acaacgactcctgaagaagtgggcgatacggctctctttttattaagtgatatgtcccgc
ggtattaccggagaaaatatccatgtcgattctggatatcatataatggggtaa

DBGET integrated database retrieval system