KEGG   Bacillus muralis: ABE28_012975Help
Entry
ABE28_012975      CDS       T05340                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bmur  Bacillus muralis
Pathway
bmur00020  Citrate cycle (TCA cycle)
bmur00310  Lysine degradation
bmur00380  Tryptophan metabolism
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
bmur01120  Microbial metabolism in diverse environments
bmur01130  Biosynthesis of antibiotics
bmur01200  Carbon metabolism
Module
bmur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmur00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE28_012975
  Amino acid metabolism
   00310 Lysine degradation
    ABE28_012975
   00380 Tryptophan metabolism
    ABE28_012975
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ABE28_012975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOH55266
UniProt: A0A1B3XPY4
LinkDB All DBs
Position
complement(2678875..2681727)
Genome map
AA seq 950 aa AA seqDB search
MTIKDAKAYDPWRAFSGPNLGYVMEQYDLFQANPEEVDPELKNFFEVSGPPSFDVSAETT
IGSAPIVQTGEVLPMKKIMSAVKLAENIRAYGHLAANIYPLKEEALDTEQIHFEKYGLTA
DDLRKIPADFICPESPKDVKDGYDAVQYLKQLYTKTIAFEFHHVNDLEEKQWLTDMVESG
SMFPEVTKEKRELLLKRLNEVEGFEKFLHRTYVGQKRFSIEGLDILVPILDEMISQTVQN
GTGNVNIAMAHRGRLNVLAHVLGKPYEVIFSEFQHSPNKDLVPSEGSTGINNGWTGDVKY
HLGLDKQITKANIQKARITLANNPSHLEVVGPIVEGYSRAAQEDRSAKGFPAQDISKSLA
ILIHGDAAFPGEGIVPETFNLSRLRGYQVGGAIHIIANNMIGFTTESEDSRSTKYASDLA
KGFEVPIVHVNADDPEACIAAVNLANQYREKYKKDFLIDLIGYRRFGHNEMDEPLVTQPE
MYALIHKHKTVKDLYGNKLIHSGEFTEEEVKAIAEQVDTRLADAYAKISGNKPEASKECN
PPGIIEKGIPTIETGVPKQELVSINEELVQWPEGFTPNKKLGKILSRRLDSFAPEGKIDW
AHAETLAFATILNDATPIRLTGQDSERGTFAQRNIMLHDSVNGKTYSPLHTLEMAKASFA
VHNSPLTETAVLAYEYGYNVFAPETLVLWEGQFGDFANTAQVIFDQFIAAGRAKWGQKSG
LVMLLPHGYEGQGPEHSSARLERFLQLAAENNWTVANLSSAAQYFHILRRQAKILDQEQV
RPLVIMTPKSMLRNQVMASASSEFSEGSFESFMETKALGKKPKSVERIVFATGKLAVELR
EKAAAEKNTEWLQIISIEEIYPFPFTGVQEALKKYTNLKEIFWAQEEPKNMGAWTFVEPR
LNAAAPRNLSVTYIGRKRRSSPAEGDPLVHKNEQQRIMTQAITRNNEGEK
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaggatgctaaggcatacgacccatggagagctttttcaggtccaaacctt
gggtatgtcatggagcaatacgatctatttcaagccaatccggaagaagtagatccggag
ctgaaaaacttttttgaagtatcaggtcctccttcattcgatgtatcggcagaaacgaca
atcggaagtgcaccaattgtacaaactggagaagttcttccaatgaagaaaattatgtct
gcagtgaagctagcggaaaacatccgcgcttacggacatcttgctgcgaacatttatcct
ttaaaagaagaagcactggatactgaacaaattcactttgaaaaatacggcttaactgca
gatgacttaagaaagataccggctgactttatttgtccagaatcaccaaaggacgtaaaa
gacggatacgatgccgtacaataccttaaacaactttatacaaaaacgatagcctttgaa
tttcaccatgttaatgacttggaagaaaagcaatggcttacagatatggtcgaatccgga
agcatgttcccggaagtgactaaagagaaaagagaactgttactaaaacggctgaatgag
gtggaagggtttgaaaaattccttcaccgcacatatgtcggccaaaaacgtttttctata
gaaggtctagatatattagtgcctatcctagatgaaatgatttcacagacggtccaaaac
ggaacaggtaatgtaaatatcgccatggcccaccgcggacgcttgaatgtgcttgcacat
gtactaggcaagccatatgaagtcatcttctcggaatttcaacattcgccaaataaagat
ttggttccttccgaaggttcgacagggattaacaatgggtggacaggtgatgtcaagtat
catttaggtcttgataagcaaatcaccaaagccaacatacaaaaagcaagaatcactctt
gccaataaccctagtcacttggaagtagtcggtccaatcgtggaagggtattcccgtgcg
gcacaagaagaccgttcggcaaagggattcccagcacaggatatttccaagtcactagcc
atcctgatacatggtgatgcagcgttcccaggtgagggaattgtaccggaaacattcaac
ttaagccgtttacgcggatatcaagttggtggtgccatccatatcatcgccaataacatg
attggttttacaacggaaagtgaagattcacgttcaaccaaatatgccagtgatttggct
aaaggctttgaagtgccgatcgtgcatgtgaatgcggatgatcctgaagcatgtatcgct
gcagtgaaccttgctaaccaataccgtgagaaatataaaaaagatttcttgatcgatttg
atcggttatagacgtttcggccataacgaaatggatgagccgttggtgactcaacctgaa
atgtatgctttgatccataagcataaaacagtcaaagacctttatgggaacaagctgatt
cattctggtgagttcacggaagaagaagtgaaagctatcgcagagcaagtggatacaagg
cttgccgacgcctatgcgaaaatttctggaaacaaaccagaagcttctaaagagtgtaac
cctcctggcatcatcgaaaaaggaattccgaccatcgagacaggagttccgaagcaagaa
ctggtttcgatcaacgaagaacttgttcagtggccggaaggattcactcctaataagaaa
ttaggaaagatcttgtcacgtcgcttggattcctttgcacctgagggtaaaattgattgg
gctcatgccgaaacgctagcatttgcgaccattttgaacgatgctacgccaattcgcttg
acagggcaagattcagagcgcggaacattcgctcagcgtaatatcatgttacatgacagt
gtgaatggaaaaacttattcaccacttcacacacttgaaatggccaaagcttctttcgct
gtccataacagcccgctgactgaaacggcagttttagcgtatgaatatgggtataacgta
ttcgcgcctgaaacactggtactatgggaagggcaattcggggatttcgccaatactgca
caagtcatctttgatcaattcatcgctgccggccgtgcaaaatggggtcagaaatcagga
cttgtcatgctgcttccgcacggatatgaaggacaaggaccagagcactcaagtgcacgc
cttgaacgtttcctgcaattggcggctgagaacaactggaccgttgccaacttaagttcg
gcagctcaatacttccatatccttagaagacaagctaagattttggatcaagagcaagta
cgcccgcttgtcatcatgacaccgaagagcatgcttcgtaaccaagtgatggcttctgca
tcttcggaattcagcgaaggttcgtttgaatcgttcatggaaacgaaggcgttaggcaaa
aaacctaaatcggttgaacgcattgtcttcgcaaccggtaagttggctgttgaacttcgt
gaaaaagcggcagctgaaaaaaatacggaatggctgcaaatcatcagtatcgaagagatt
tacccattcccattcactggggttcaagaagcgttgaaaaaatatacaaacctgaaagaa
atcttctgggctcaagaagaacctaaaaatatgggggcttggacatttgttgaaccacgc
cttaatgcagcggctcctcgtaacctttccgtcacatatatcggaaggaaacgcagatca
agcccggctgagggagatccacttgtccataaaaatgaacaacaacggattatgactcaa
gcgatcacacgcaataatgagggggagaaataa

DBGET integrated database retrieval system