KEGG   Bacillus muralis: ABE28_013270Help
Entry
ABE28_013270      CDS       T05340                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bmur  Bacillus muralis
Pathway
bmur00220  Arginine biosynthesis
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
bmur01130  Biosynthesis of antibiotics
bmur01210  2-Oxocarboxylic acid metabolism
bmur01230  Biosynthesis of amino acids
Module
bmur_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ABE28_013270
Enzymes [BR:bmur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     ABE28_013270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3762 Peptidase_M28 Vps5
Motif
Other DBs
NCBI-ProteinID: AOH55323
UniProt: A0A1B3XQ29
LinkDB All DBs
Position
complement(2743715..2744986)
Genome map
AA seq 423 aa AA seqDB search
MDMYEDKIRTWLDDSRTKAIQLLQKLVQEPSKRGQEGSAQAIVVEKCRQLGLEIDLWEIG
DEHLRNHPHFYCDRKDFKGNPNLVAIKRGTGTGKSIILNGHIDVVPEGDHSAWQDDPYSG
RLIDGKVFGRGTTDMKGGNVSLLLAIEAIVESGIQLKGDVIFQSVIEEESGGAGTLAAVI
RGYKADGAIIPEPTNMKLFPLQQGSMWFRLIVTGKSAHGGTRYEGVSAIEKAMLVMKEIK
QLEQERNEPLRHSLYKNVPIPIPINIGSMQSGNWPSSVPDTAVLEGRFGIAPTETMEQAQ
NSLIQLIESMNERDEWFKEKPMKLEWFGARWLPGSLETDHPLMKTIGTNYELVKGKEPVV
EASPWATDGGYLSTVGSTPVVVFGPGETKMAHDANEYIEVDRMMEAAKIIALTIIDWCEA
EQL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtatgaggataaaataagaacatggctggatgattcacggacaaaggcgatt
caattgttgcaaaagctggtccaggaaccgagcaagagaggacaggaaggaagcgctcaa
gccatagtagtcgagaagtgcagacaactcggacttgaaatagatttgtgggaaatcggg
gatgagcatttgcggaatcatcctcatttttattgtgatcgcaaggattttaaaggaaat
ccgaatcttgtcgcgataaaaaggggaaccggcacagggaagtccattattttgaacggt
cacattgatgtcgttcctgaaggtgatcattcagcatggcaggacgatccgtatagtggc
agattaatagacggaaaagtattcggaaggggaacgaccgatatgaaaggcggcaatgtt
tccttgttgctggcgattgaagcgatcgtcgagtcaggtatccaattgaagggagacgtg
atttttcaaagtgtgattgaagaggaaagcggcggtgccggaacactagccgcggtcata
cgcggatataaagcggatggggcaatcatcccggaacctaccaatatgaaactatttccc
ctacagcagggatcgatgtggtttcggctgatagtaactggtaagtctgcgcatggaggc
acaaggtatgaaggagttagcgccatcgaaaaagccatgttggtcatgaaagaaatcaag
caacttgaacaagaacggaacgagccactccgtcattcactttataaaaatgtccccatt
ccgattcctattaacataggaagcatgcaaagcggcaactggccttcttccgtgcccgat
acagccgttcttgaaggtcgatttggcattgctcctaccgaaaccatggagcaggcgcag
aattcgctaatacagttgatcgaatccatgaatgaacgtgacgaatggttcaaggaaaag
ccgatgaaattggaatggtttggcgccaggtggctgcctggcagtctcgaaacggaccat
ccgctaatgaaaacgattggaacgaattatgaattggtgaaggggaaagaaccggtcgtc
gaagcatctccatgggcgacggatggaggctatctgtcaacggtgggatcgactcccgtc
gtcgtatttggaccgggagaaacgaagatggcccatgacgccaacgaatatatagaagtg
gacagaatgatggaggctgcgaaaatcatcgccttgaccattattgattggtgtgaggcc
gagcagctctaa

DBGET integrated database retrieval system