KEGG   Bacillus muralis: ABE28_013555Help
Entry
ABE28_013555      CDS       T05340                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bmur  Bacillus muralis
Pathway
bmur00010  Glycolysis / Gluconeogenesis
bmur00053  Ascorbate and aldarate metabolism
bmur00071  Fatty acid degradation
bmur00280  Valine, leucine and isoleucine degradation
bmur00310  Lysine degradation
bmur00330  Arginine and proline metabolism
bmur00340  Histidine metabolism
bmur00380  Tryptophan metabolism
bmur00410  beta-Alanine metabolism
bmur00561  Glycerolipid metabolism
bmur00620  Pyruvate metabolism
bmur00625  Chloroalkane and chloroalkene degradation
bmur00903  Limonene and pinene degradation
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
bmur01120  Microbial metabolism in diverse environments
bmur01130  Biosynthesis of antibiotics
Module
bmur_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABE28_013555
   00053 Ascorbate and aldarate metabolism
    ABE28_013555
   00620 Pyruvate metabolism
    ABE28_013555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE28_013555
   00561 Glycerolipid metabolism
    ABE28_013555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE28_013555
   00310 Lysine degradation
    ABE28_013555
   00330 Arginine and proline metabolism
    ABE28_013555
   00340 Histidine metabolism
    ABE28_013555
   00380 Tryptophan metabolism
    ABE28_013555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABE28_013555
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABE28_013555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABE28_013555
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ABE28_013555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOH55379
UniProt: A0A1B3XQ89
LinkDB All DBs
Position
complement(2795761..2797188)
Genome map
AA seq 475 aa AA seqDB search
MRNYTQQYINGEWVDSTGSETIDVINPATEEVIGKIISGTKEDVDRAVEAARAAFPSFSR
MQIEERIKLLENIAKEYENRKDDLVKVMTEELGSPITRSEQVQYEMGLQHFKEAAEKLKT
FEFTEQRGDTFIQKEAIGVAGLITPWNFPANQVCTKLASAFAAGSTVVLKPAAMTPLTAI
ILAEIFEKAGMPKGVFNLVNGSGSTIGEAISSHPDIDFVSFTGSGSVGSKIMENAAQDIK
KVSLELGGKSPLVILQDANVKEAARTAVLNVAMNTGQVCTAATRTIIPKSMQDEFIEAIK
EVLPEFPVGDPQDEATFMGPQVSEGQWKTVQSYIEKGMDEGAVLVAGGTGKPEGLEKGYF
TKITVFSDVKSDMTIAKEEIFGPVMSILTYETIDEAIEIANDTIYGLAGYVFGQDPEQLR
KVATNIRAGQITVNNAKIDYSAPFGGFKQSGIGREWGDYGIEEFLEPKAILGMPS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaattatacacaacagtatatcaatggagaatgggttgattctacagggtcggaa
acgattgatgttatcaatccagctacggaagaagtcatcggaaagatcatttcgggtacc
aaggaggatgtcgaccgcgcagttgaagcggctcgtgcagcatttccttcattctctaga
atgcaaatagaagagcggatcaagttattggagaatatcgccaaggaatatgaaaatcgg
aaggatgaccttgtcaaagtcatgacagaagaattaggttctcctattacacgaagtgaa
caagttcagtatgagatgggcttgcagcattttaaggaagcggccgagaagctgaaaacc
ttcgaattcacggaacagcgcggagacaccttcatccaaaaagaggcgattggtgtagcc
ggactcattacaccatggaatttccctgccaaccaagtttgcacgaagttggcgagtgca
tttgctgcaggaagcacagtcgtattgaagcctgctgccatgacgccgcttacagcaatc
attctcgcggaaatcttcgaaaaggctggaatgccaaaaggtgtatttaatctagtgaat
ggctctggttccaccattggggaagcgatcagctcccaccctgatatagattttgtttca
tttactggatctgggagcgtcggttcaaaaatcatggaaaacgccgctcaggatataaag
aaagtgtcactcgaacttggcggcaaatccccattagtgattttacaagacgccaatgta
aaagaagccgcgcgaaccgctgttttgaatgtggcgatgaatactggacaagtttgtacg
gctgcaacgaggaccatcattcctaaatcgatgcaggatgagtttattgaagcgataaaa
gaggtgcttccggaattccctgtaggagatccgcaggacgaggccaccttcatgggtccg
caagtatcggagggacagtggaaaacggtccaatcctacattgaaaagggaatggacgaa
ggggcggtacttgtcgctggaggcacaggaaaaccagaaggccttgaaaaaggttatttc
acgaagattacggttttctctgatgtgaaaagcgatatgacgatagccaaagaagaaata
ttcggtcccgtcatgtccattcttacgtatgaaaccattgacgaagcgattgagatcgcc
aatgatacgatttatggtttagctgggtatgtgttcggccaggacccagagcaattgaga
aaagtggctacgaatattcgggctggtcagataaccgtcaacaatgcaaaaatagactat
tcagcaccgtttggcgggttcaagcagtcaggaatcggacgtgaatggggcgattacgga
attgaagaattcctggagccaaaagccattctggggatgccgtcttga

DBGET integrated database retrieval system