KEGG   Bacillus muralis: ABE28_014500Help
Entry
ABE28_014500      CDS       T05340                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
bmur  Bacillus muralis
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bmur03009]
    ABE28_014500
Enzymes [BR:bmur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     ABE28_014500
Ribosome biogenesis [BR:bmur03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABE28_014500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 SUKH-3 DUF348
Motif
Other DBs
NCBI-ProteinID: AOH55566
UniProt: A0A1B3XQS3
LinkDB All DBs
Position
complement(2991906..2992646)
Genome map
AA seq 246 aa AA seqDB search
MERLQKVIAHAGLASRRKAEELILEGKVKVNGKVVKELGVKVGPNDKVEVNEVPLEKEAP
VYFLFYKPRGVISAVSDDKNRKVVTDYFPYINERIYPVGRLDYDTSGLLVLTNDGEFANT
LMHPKHEVDKVYVAKVKGMPLRESLKKLEKGIKLEDGKTAPAKTRVLSTDKKKETAIVEI
TIHEGRNRQVRRMFEAIGHPVIKLKREQYGFLTLDGLTAGDSRELTPHEVKLMRTMASTD
PKQRRM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaacgattacaaaaggtgatagcgcatgctggactggcttcccgccgtaaagcagaa
gagttgattttggaaggtaaggtcaaggtgaatggcaaagtagtgaaggaattgggtgtg
aaggtgggtcctaatgataaggttgaggtcaatgaagtcccgcttgaaaaagaagctccg
gtttatttcctcttctataaaccgcgcggggtcatttcggccgtttcggatgataagaat
agaaaggtcgttacggattatttcccttacatcaatgaacggatatatccagtcggtcgc
ttggattacgatacatccggtttgttggtattgaccaatgacggagaatttgcaaataca
ttaatgcatcccaagcatgaagtggataaagtgtatgtggcaaaagtgaaaggaatgcct
cttcgtgagagtttgaaaaagctggaaaaaggcatcaagctggaagatggcaagacagcc
ccagccaagacaagggtattgtcgaccgacaaaaaaaaggaaacggccattgttgaaatc
acgatacatgagggcaggaacagacaggtacgccgcatgttcgaagcgattggacatccc
gtgattaaattgaagcgggaacaatacggatttttgaccttggatggcttaactgcaggg
gattccagggagcttactccgcatgaggtcaaattgatgcgtaccatggcatcgaccgac
cctaaacaaagaaggatgtaa

DBGET integrated database retrieval system