KEGG   Bacillus muralis: ABE28_015265Help
Entry
ABE28_015265      CDS       T05340                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmur  Bacillus muralis
Brite
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABE28_015265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOH55719
UniProt: A0A1B3XR60
LinkDB All DBs
Position
complement(3144107..3144715)
Genome map
AA seq 202 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNNALEGNQELLSKSVEEIVAN
LDAVPEAARTAVRNNGGGHANHTLFWEILSPNGGGQPTGELADAITSKFGSFDSFKEEFA
KAATTRFGSGWAWLAVNNGELEVTSTPNQDNPLSEGKTPLLGLDVWEHAYYLNYQNRRPE
YINSFWNVVNWDEVSKRYNAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaacttccgcaattaccgtacgcatatgatgcattggaaccacacatcgac
aaagaaacaatgaacattcaccacactaaacatcacaacacatatgtgacgaacttgaac
aatgcccttgaaggcaaccaagagcttctaagcaaaagcgttgaagaaatcgtcgctaac
ctggatgcagtacctgaagcggctcgcactgcagttcgcaacaatggaggcggacacgct
aaccacacattattctgggaaatcctttcaccgaacggtggcggacagccaactggtgaa
ttagcagatgcaatcacatctaaattcggcagcttcgacagctttaaagaagagttcgca
aaagcggctaccacccgctttggatctggctgggcttggcttgccgtcaacaatggagag
ttggaagtaacaagcactccgaaccaagacaatccattatctgaaggcaaaacgccactt
cttggattggacgtttgggaacatgcttactacctaaactaccaaaaccgtcgtcctgaa
tacatcaattccttctggaatgttgtaaactgggatgaagtgtctaaacgttacaacgct
gctaaataa

DBGET integrated database retrieval system