KEGG   Bacillus muralis: ABE28_016435Help
Entry
ABE28_016435      CDS       T05340                                 

Definition
(GenBank) spore coat protein YsxE
Organism
bmur  Bacillus muralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH
Motif
Other DBs
NCBI-ProteinID: AOH55951
UniProt: A0A1B3XRX5
LinkDB All DBs
Position
complement(3380211..3381281)
Genome map
AA seq 356 aa AA seqDB search
MRENENQQSANRDRDTESVLKEYALYVQYIEDFGRVKKVYSDRGTFALKSILPHNGIDFI
KNVQKLYHRGYNRIVPIYQTMDQRYAVLHNGRLYYLMPWLNNEGDGERDEKHKQMFRELA
RMHTLTVKDIQVDIEEREAHYERTLDAWNNEKDFMDEYIVSCEKKWYMSPFEMSVCTFFT
DISQALKYSIKKFETWYEKTKESEKVRTVVTHGKVSLKHFVYDERGYGYFINFENSNTAP
PHFDLLPFLVKSARTYPVQCDDCVDWLYNYMRYFPLKEEELLLMQSYLAFPGSALELVKG
YSDGRSKRSELDHVTQLQRQFWLLKNVEYMVMKIEEIEQQKKAAAEAAKEEQSPSS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgagggaaaacgagaatcagcagtcggctaatcgggatcgggacacggaatccgtcttg
aaggaatatgccctttatgtacaatatattgaggatttcggacgggtgaagaaagtatat
agtgatcgtggtacgtttgccttgaaatcgatattaccgcataatgggatcgattttata
aaaaatgtccaaaagctgtaccatcgcggttataatcggatcgttcccatctatcaaacg
atggatcaacgttatgccgtcctccataatggccggttgtattacttgatgccctggctg
aacaacgaaggggatggggagcgcgatgagaagcataagcaaatgttccgggagcttgcc
cggatgcatacgctgaccgtaaaggatatacaagtggatatagaagaacgggaagcgcac
tatgagcggacgcttgatgcttggaataacgagaaggactttatggatgagtatattgtc
agctgtgaaaagaagtggtatatgtcgccgttcgaaatgtcggtatgtacgttcttcact
gatatttcacaggcactgaagtattcgataaagaagttcgaaacctggtatgagaagacg
aaggaaagtgaaaaggttcgaaccgtagttactcatggtaaggtttcccttaagcatttc
gtttatgatgaacggggatatggttattttatcaattttgagaattcgaatacggcgccg
ccacatttcgatttattgccttttctcgttaaatctgcgaggacgtatccagtccaatgt
gatgactgcgtcgactggctatataattacatgcgctattttccgcttaaggaggaagag
ctgctgctcatgcagagctatttagcttttcctgggtcggctttggaattggtgaagggg
tattcggatggcaggtcgaagcgttcagagcttgatcatgtcacccagttgcagcggcaa
ttctggttattgaagaatgttgagtatatggtgatgaaaatcgaggaaatcgaacagcag
aaaaaggcagctgccgaggccgccaaagaagagcaatcaccctcaagctaa

DBGET integrated database retrieval system