KEGG   Peribacillus muralis: ABE28_019140
Entry
ABE28_019140      CDS       T05340                                 

Definition
(GenBank) hypothetical protein
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bmur  Peribacillus muralis
Pathway
bmur00998  Biosynthesis of various secondary metabolites - part 2
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
Module
bmur_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    ABE28_019140
Enzymes [BR:bmur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     ABE28_019140
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C OKR_DC_1
Other DBs
NCBI-ProteinID: AOH56486
UniProt: A0A1B3XTD8
LinkDB
Position
3936897..3938102
AA seq 401 aa
MEISPSKTVSSLPDQEFSVIINKVNELTNKGIDVINVGQGNPDLPTPPHIVNSLIEAANK
SGFHKYSPFRGHKFLKEAISKFYKREYDVEIDPDKEVVIFNGGKAALYAVSQSLLNPEDV
ALIPDPGYPEYLSGIMMARAHPYYFKVTPTNNYLPVYNDIDQEVLEQAKLLYLNYPNNPT
GATANREFFNETVKTAEKNNICVVHDFAYAGFGFDEQKPISFLSSPGAKGVGIEIYTLSK
TYNMAGWRVAFAVGNEKVIQAINTFQDHIFVSLFGAVQQAAATALESDQSCVKDLNSVYE
SRAEHFIQACQRELDWKIQKPQGTFYVWAKIPNGFDSFTFTELLLNEAHIAVTPGEVFGV
NAKDYIRLSMVTSTERLDELVKRIKSLNINFSSIEKVPETI
NT seq 1206 nt   +upstreamnt  +downstreamnt
attgaaatatcaccatcaaaaacagtaagttcattgccagatcaggagttttcagtgatt
attaataaagtaaatgaacttactaataaggggatagatgtaataaatgtaggtcaaggt
aatccagacctaccaactcctcctcatatcgttaactctttaatagaagctgctaataaa
tcgggattccataagtattcaccatttagaggtcataagtttctcaaagaagcaatcagt
aaattttataaacgcgaatatgatgtagaaattgatcctgataaagaagtagttatattt
aacgggggtaaagctgctttatatgctgtgagtcaatctctactaaatcctgaagatgtt
gccttaattcctgatccgggctatccagaatacctttccggcataatgatggcgagagca
catccttattattttaaagttacaccaactaataactatcttcctgtttataacgatatt
gatcaagaagttctggaacaagcaaagttactttacttaaattatcctaataatcctact
ggcgcaacagcaaatagagaatttttcaatgagacagtaaagaccgcagagaaaaataat
atatgtgtagttcatgattttgcatacgcagggtttggatttgacgagcaaaaaccaatt
agctttctgtcatcacctggtgctaaaggtgtaggcatagaaatttatacactttctaag
acctataatatggccggatggcgagtagcttttgctgttggtaatgagaaagttatacaa
gcaattaatacttttcaagatcatatatttgttagtctttttggcgctgtacaacaagca
gccgctacggctctagagagtgatcaaagctgtgttaaagacttgaacagtgtctatgag
tctagagctgaacattttattcaagcttgtcagagagaattggattggaaaattcaaaaa
ccccaaggaacattttatgtttgggctaaaatccctaatggttttgattcttttactttt
actgaactattactaaatgaggctcatattgctgtgacgcctggtgaagtatttggggta
aatgctaaagattatattagactttcaatggtaactagcacagaaagactggatgaatta
gtaaaaaggattaaatcattaaatattaacttttcatctatagaaaaggtgccagaaaca
atataa

DBGET integrated database retrieval system