KEGG   Bacillus muralis: ABE28_021690Help
Entry
ABE28_021690      CDS       T05340                                 

Definition
(GenBank) sporulation protein YunB
Organism
bmur  Bacillus muralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YunB
Motif
Other DBs
NCBI-ProteinID: AOH56967
UniProt: A0A1B3XUR6
LinkDB All DBs
Position
4453487..4454233
Genome map
AA seq 248 aa AA seqDB search
MFRKRFRPMKFRKKGPLPTRKVFLYSFILFIISSIMTLWYVDKAIEPVIMNVAENEIKRI
ATETIHESVDENIAKIDMKEIITNNKGSEGTSSSYSFNPAVYSELRANITNDIQDKLGIK
QGNPFKTGSTKINDEQYKSVVYYIPLGVVTGNNLLSNYGPEIPVKMSVIGNVESDLRTKL
TNAGINNVYYELIVDFDVNIQIVIPSFTKETKVSQEVTVGSLLIEGDVPSYFSNGNGAVA
PAIMKENK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgaaaaagatttcgcccaatgaaatttcgtaaaaaggggcctctccctacccgc
aaagtatttctatattcattcatcctttttatcatatcgagcatcatgacactttggtat
gttgataaggccatcgagcctgtaatcatgaatgttgccgaaaatgaaatcaaaaggatt
gccacggaaacgatccatgaatcggtcgatgagaatatcgccaaaattgatatgaaggaa
atcatcaccaacaataaaggcagcgaaggcaccagttcctcctatagcttcaatccagcc
gtatacagtgaattgcgcgctaacattacaaacgatatccaagacaagcttggcatcaaa
cagggaaatccttttaaaacgggttcaaccaaaataaatgatgaacaatataaaagcgtg
gtctattatataccattaggcgtcgtgaccggaaacaacctcctttccaactatggacct
gaaatcccagtgaaaatgtcagtcatcggcaatgttgaatcggacctgagaacgaaactg
acgaacgccggcattaataatgtttattatgagttgatcgttgattttgatgtcaacatc
caaatcgtcatcccctctttcactaaagagaccaaggtaagccaggaagtgacagtcggc
agcttattgatcgaaggtgatgtaccaagttatttcagtaatggaaatggagccgtcgcc
cctgccatcatgaaagaaaacaaataa

DBGET integrated database retrieval system