KEGG   Bacillus muralis: ABE28_021810Help
Entry
ABE28_021810      CDS       T05340                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bmur  Bacillus muralis
Pathway
bmur00071  Fatty acid degradation
bmur00280  Valine, leucine and isoleucine degradation
bmur00281  Geraniol degradation
bmur00362  Benzoate degradation
bmur00592  alpha-Linolenic acid metabolism
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
bmur01120  Microbial metabolism in diverse environments
bmur01130  Biosynthesis of antibiotics
bmur01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE28_021810
   00592 alpha-Linolenic acid metabolism
    ABE28_021810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE28_021810
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    ABE28_021810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE28_021810
   00642 Ethylbenzene degradation
    ABE28_021810
Enzymes [BR:bmur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     ABE28_021810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOH56991
UniProt: A0A1B3XUZ2
LinkDB All DBs
Position
complement(4476814..4477992)
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVAGARTPVGRAKKGSLANVRPDDLGALVVKETLKRAGNYEGTIDDLIIGCAMPE
AEQGLNMARNIGALAGLPYTVPAITINRYCSSGLQSIAYGAERIMLGQSDTVIAGGAESM
SLVPMMGHVTRPNAQLAESAPEYYMGMGHTAEAVAKKYGISRDDQDAFAVRSHQRAAKAI
AEGKFSDEIVPVDVTLRSVGPDLKLKEKSFTFAQDEGVRAGTTTDVLKKLRPAFSVTGSV
TAGNSSQTSDGAAAVMVMDGEKASSLGMKPIGKFRSFAVAGVPPEIMGIGPIAAIPKALK
LAGLELSDIGLFELNEAFASQSIQIIRELGLNEEIVNVNGGAIALGHPLGCSGAKLTLSL
LHEMKRRNQQFGVVTMCIGGGMGAAGVFELLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcggtaatagttgctggagcaaggactccggtaggaagagcgaagaaaggt
tctcttgctaatgttcgtccggatgatctaggtgctctagttgtaaaggaaacgttaaag
cgcgcaggaaattatgaaggaacgatcgatgatctgattatcggctgtgcgatgcctgag
gcggagcaaggtctgaacatggcacgcaacatcggcgcattggcaggattgccttataca
gtaccagcgataaccatcaatcgttactgttcaagcgggctccaaagcattgcatatgga
gcggagagaatcatgctcggtcaaagcgatacagtcattgccggcggtgcggagtcgatg
agccttgtaccgatgatgggccatgtaacgcgaccgaatgcgcagcttgccgagtcagca
ccggaatattatatgggaatgggccacacggctgaagcggttgcgaagaaatatggcatc
tcccgcgatgatcaagatgcttttgctgtaagaagccaccagagggcggcaaaggccatt
gccgaaggaaagttctccgatgaaatcgtaccggttgatgtaacccttcggtcggttgga
cctgatctgaaattaaaggaaaagtcattcacattcgcacaagatgagggcgtgcgtgca
ggaacgacgacggacgtactcaaaaaactaagacctgcattctccgttaccggatccgtc
acagcagggaactcatcacaaacgagtgatggagcggccgcggtcatggtcatggatggg
gaaaaggcatcttcattgggaatgaagccgattggtaagttccgttcctttgcagtggca
ggagtaccgcctgaaattatggggatcggtccaatcgctgccattccgaaagctttgaaa
ctggcaggtctggagttatccgacattggtttatttgaattgaatgaagcttttgcttct
caatccatccagatcattcgtgagctgggattgaatgaagagatagtcaatgtgaatggc
ggtgcgattgccttaggtcatccgcttggctgttcgggagctaaattgacattaagccta
ttacatgaaatgaagcgcagaaaccaacagttcggagtcgtgacaatgtgtatcggcggc
ggaatgggtgctgctggagtctttgaattattagcgtaa

DBGET integrated database retrieval system