KEGG   Bacillus muralis: ABE28_023605Help
Entry
ABE28_023605      CDS       T05340                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bmur  Bacillus muralis
Pathway
bmur00500  Starch and sucrose metabolism
bmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABE28_023605
Enzymes [BR:bmur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ABE28_023605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AOH57344
UniProt: A0A1B3XVV3
LinkDB All DBs
Position
4864331..4865812
Genome map
AA seq 493 aa AA seqDB search
MKRNHTMMQFFEWHLEADGSHWDRLKYAASKLKDTGIDCVWLPPVTKGQSIGDNGYGIYD
GYDLGEFDQKGTIRTKYGTKEELHQAIATCHNYGLCVYIDLVMNHKAGADGTEKFEVIEV
NPENRMEDISEPFEIEGWTTFDFPGRNNQYSDFKWNHEHFNGTDYDAENDKMGVYRITGE
NKHWNKHVIDEFGNYDYLMFANIDYSLPEVRQEMITWGKWMVDTLKCDGFRLDAVKHIDY
EFINDFLQELIPYTNEHFFMVGEFWKADVKACQNYLEQTNHDLNLFDVSLHYKFHEASNA
GSDFDLSTIFDDTLVKTNPEQAVTFVDNHDSQPHESLESWVKDWFKPSAYALILLRLCGY
PCVFYGDYYGIGGPSPVPGKKDILDRLLHARYEKAYGEQKDYFDDPNTVGWVRLGVDELQ
GSGCAIIVSNADNNSEKRMFVGEHRAGEIWTDLTFHRDDHITIEEDGYATFPVHGKSVSV
WALNDTPLGAAQS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatcatacgatgatgcaatttttcgagtggcatcttgaggcagatggttca
cattgggacagattgaaatatgcggcctccaagttgaaggatacaggtattgattgtgtt
tggcttccgcccgttaccaaagggcagtccattggtgataatggttatggaatatatgac
gggtacgatttaggcgagtttgaccaaaaaggaacgatccgtaccaaatatgggacaaaa
gaagaactgcaccaagcaatcgccacctgtcataattacggactttgcgtctacatcgat
ttagtcatgaatcacaaagctggcgctgatggaaccgagaaattcgaagtcattgaggtc
aatccggaaaaccgcatggaagatatatcagagccattcgaaatcgaaggctggacgaca
ttcgactttccgggacgtaataaccaatactctgatttcaagtggaaccatgaacatttc
aacgggactgactatgatgccgaaaacgacaaaatgggtgtctaccggataacaggggaa
aacaaacactggaacaagcacgtcattgatgaattcggcaactacgattatttaatgttc
gcgaatatcgattacagcctgccggaagtccgccaggaaatgattacttggggaaagtgg
atggttgatacattaaaatgtgatggcttccgcttggatgcagtgaagcatattgattat
gaattcattaatgactttttacaagaactcattccttatacaaacgaacattttttcatg
gtcggcgagttttggaaggccgatgttaaagcttgtcaaaattatttggagcaaaccaat
catgacctcaatttgttcgatgtttccctgcattataaatttcacgaggcctcaaacgca
ggatctgacttcgatctctcaaccatctttgatgataccctcgttaaaaccaatccggaa
caggctgtcacctttgtcgacaaccatgactcccagcctcatgaatcactggaatcgtgg
gtgaaggattggtttaaaccatctgcatatgccttaatcctgcttaggctttgcggatat
ccctgtgtcttctatggggactattacggaattggcggcccttctccggtcccaggcaaa
aaggatatattggatcgccttttgcatgccaggtatgaaaaagcgtatggggaacagaag
gactattttgatgacccaaatacagtaggctgggtccgtttaggggtcgacgagctgcaa
ggctcggggtgtgccatcattgtcagcaatgcagataacaacagcgaaaaaagaatgttc
gtgggtgaacaccgtgctggcgaaatctggactgatttaacttttcaccgagatgatcac
atcaccattgaagaagacggctacgcgacctttcccgtacatggaaagagcgtatctgtt
tgggccttgaatgatacgccgcttggagcggcacaaagctga

DBGET integrated database retrieval system