KEGG   Burkholderia mallei SAVP1: BMASAVP1_0832Help
Entry
BMASAVP1_0832     CDS       T00457                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00550  Peptidoglycan biosynthesis
bmv01100  Metabolic pathways
bmv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMASAVP1_0832
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BMASAVP1_0832
Enzymes [BR:bmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BMASAVP1_0832
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BMASAVP1_0832
Glycosyltransferases [BR:bmv01003]
 Polysaccharide
  Bacterial polysaccharide
   BMASAVP1_0832
Peptidoglycan biosynthesis and degradation proteins [BR:bmv01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BMASAVP1_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ABM49202
LinkDB All DBs
Position
II:complement(841221..843362)
Genome map
AA seq 713 aa AA seqDB search
MTDHTPHSSPPASPTPPQGPAPKRRRYFRTLAGLVLGAAIAVGAVGTWTLHRIWTALPSV
EPLAVYRPALPLRIFSREGELLAEYGVERREFVPLDRIPPLVRHALLAAEDAQFYTHGAV
DIGGLARATVANVVTGQPGQGGSTITMQVARNFFLTREKVLSRKLAEILMSYKLERAYSK
DKLLELYMNEIYLGERAYGFAAAASVYFGKPLDALTPGEAAVLAGLPKAPSAFNPVVNPA
RATMRRNYVLGRMRALGYLDEAAYRQAADAPIALATTPPPGILAAPYVAERARRMMVERF
HDDAYTLGLDVTTTIAMREQRAADAALARGLAQVGRRDAKDALEGALVSIDAATGDILAL
VGGADFSHNVFDHALQAYRQPGSSFKPFVYSAALEKGMFPGVLIDDTQRTLSRDETGANP
WRPRNFGNHYEGFIPVRRGLMRSKNLVAVSLMQVARPDFVQQHAARFGFEPLRNPASLPL
ALGAGSATPLEVASAYGVFANGGVRMEPRLIESVRQRHGGALFDAQLAPGVRVISARNAF
VMDSMLRDVVAHGTARRAVALKRADAAGKTGTSNGSKDVWFAGYSSGVVSVVWMGYDAPR
SLGRATGSSAALPVWVDYMKTAVDGRGAIERTPPADVALVDGDFVYAEYANGDKCAPSLP
PFVRSPFACGAARGAPADGGAPASAAGAAGAPTPAAVDAAERARVLELFRTED
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacacgccgcactcgtcgccgcccgcctcgccgacgccgcctcaggggccc
gcgccgaagcgccgccgctatttccgcacgctcgcgggcctcgtgctcggcgcggcgatc
gcggtcggcgcggtcggcacgtggacgctgcatcgcatctggacggcgctgccgtccgtc
gagccgctcgccgtctatcgtccggcgctgccgctgcggatcttttcgcgcgaaggcgag
ctgctcgccgaatacggcgtcgagcgtcgcgagttcgtgccgctcgaccgcatcccgccg
ctcgtgcggcacgcgctgctcgcggccgaggatgcgcagttctacacgcacggcgcggtc
gacatcggcgggctcgcgcgcgcgacggtggcgaacgtcgtcaccggccagcccgggcag
ggcggcagcacgatcacgatgcaggtcgcgcgcaatttctttctgacgcgcgagaaggtg
ctgagccgcaagctcgccgagatcctgatgtcgtacaagctcgaacgcgcgtacagcaag
gacaagctgctcgagctgtacatgaacgagatctatctcggcgagcgcgcgtacgggttc
gcggcggccgcgtcggtgtacttcggcaagccgctcgatgcgctcacgcccggcgaggcg
gcggtgctcgcgggcctgccgaaggcgccgtccgcgttcaatccggtcgtcaatccggcg
cgggcgacgatgcgccgcaactacgtgctcggccgcatgcgcgcgctcgggtatctggac
gaggccgcgtaccggcaggccgccgacgcgccgatcgcgctcgcgaccacgccgccgccc
ggcatcctcgccgcgccgtacgtcgccgagcgcgcgcgccggatgatggtcgagcgcttc
catgacgacgcctacacgctcggcctggacgtgacgacgacgatcgcgatgcgcgagcag
cgcgcggccgacgcggcgctcgcgcgcgggctcgcgcaggtcggccggcgcgacgcgaag
gacgcgctcgaaggcgcgctcgtgtcgatcgacgcggcgacgggcgacattctcgcgctc
gtcggcggcgcggacttctcgcacaacgtgttcgatcatgcgttgcaggcgtatcggcaa
ccgggttcgagcttcaagccgttcgtctattcggccgcgctggagaaagggatgttcccc
ggcgtgctgatcgacgacacgcagcgcacgctgtcgcgtgacgaaaccggcgcgaacccg
tggcggccgcgcaatttcggcaaccactacgaaggcttcattccggtgcggcgcgggctg
atgcgctcgaagaacctcgtcgcggtgagcctgatgcaggtcgcgcggccggatttcgtc
cagcagcacgcggcgcgcttcggcttcgagccgctgcgcaaccccgcgtcgctgccgctc
gcgctcggcgcgggctcggcgacgccgctggaggtggcgagcgcctacggcgtgttcgcc
aacggcggcgtgcgcatggagccgcgcctcatcgaatcggtgcggcagcggcacggcggc
gcgctgttcgacgcgcagctcgcgcccggcgtgcgcgtcatctcggcgcgcaacgcgttc
gtgatggacagcatgctgcgcgacgtcgtcgcgcacggcaccgcgcgccgcgcggtcgcg
ctcaagcgcgcggacgcggcgggcaagaccggcacgtcgaacggctcgaaggacgtgtgg
ttcgccggctattcgtcgggcgtcgtatcggtcgtctggatgggctacgacgcgccgcgc
agcctcggccgcgcgacgggctcgtcggccgcgctgcccgtgtgggtcgactacatgaag
accgcggtcgacggccgcggcgcgatcgagcgcacgccgcccgcggacgtcgcgctcgtc
gacggcgatttcgtctatgccgaatacgcgaacggcgacaagtgcgcgccgtcgctgccg
ccgttcgtgcgcagcccgttcgcgtgcggcgcggcgcgcggtgcgccggcggacggcggc
gcgccggcgagcgcggcaggggcggcgggtgcgccgacgccggccgccgtcgatgcggcc
gagcgcgcgcgcgtgctcgagctgtttcgcaccgaagactga

DBGET integrated database retrieval system