KEGG   Brucella melitensis NI: BMNI_I1830Help
Entry
BMNI_I1830        CDS       T01853                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00020  Citrate cycle (TCA cycle)
bmw00310  Lysine degradation
bmw00380  Tryptophan metabolism
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01200  Carbon metabolism
Module
bmw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMNI_I1830
  09105 Amino acid metabolism
   00310 Lysine degradation
    BMNI_I1830
   00380 Tryptophan metabolism
    BMNI_I1830
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BMNI_I1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEQ09449
LinkDB All DBs
Position
I:complement(1864940..1867954)
Genome map
AA seq 1004 aa AA seqDB search
MAKQEQAPDRANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADD
VKKNAEGPSWTRKNWPIAANGELVSALDGNWAEVEKHVTDKLKGKAAKGEAKGAAGTPLT
AEEITQAARDSVRAIMMIRAYRMRGHLHANLDPLGLAEKPNDYNELEPENYGFTPADYNR
KIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDKKVAFT
PEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVL
GMAHRGRLNVLSQVMGKPHRAIFHEFKGGSYTPDDVEGSGDVKYHLGASSDREFDGNKVH
LSLTANPSHLEIVNPVVMGKARAKQDLLVGRTRDDMVPLSERAKVLPLLLHGDAAFAGQG
VVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGD
DPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMYKAIRAHKTTVQ
LYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPNKADWLDGAWAGLRTADNAD
EQRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLA
FGSLAVEAHPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLS
EEAVLGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPH
GFEGQGPEHSSARLERYLQLCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLIMMTPKS
LLRHKRAISTLAELSGESSFHRLLWDDAQYNKDEGIKLQKDAKIRRVVLCSGKVYYDLYE
EREKRGIDDVYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFIDPYLEW
VLAHIDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAFLEDALG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaagaacaagccccagatcgggccaacgacgttttcgcccttacctcattc
ctctatggcggcaatgccgactatatcgaggaactgtacgccaaatatgaggacgatccg
aattcggtcgatccgcagtggcgcgatttcttcgcgaagctgggcgataatgccgacgac
gtgaagaaaaatgcggaagggccatcctggaccagaaagaactggccgattgctgccaat
ggcgaacttgtttccgcactcgacggcaactgggccgaagttgaaaagcatgtcaccgac
aagctgaagggcaaggctgcgaagggtgaagccaagggcgctgcgggcacgccgctcacc
gccgaagagatcacacaggctgcgcgcgacagcgtgcgcgccatcatgatgatccgcgcc
tatcgcatgcgcggccatctgcacgccaatctcgacccgctcggccttgccgaaaagccg
aacgactataacgagctggagccggaaaattacggtttcacgcctgccgactataaccgc
aagatcttcatcgacaacgtgctcggcctcgaatatgcgaccgtgccggaaatgctcgac
atcttgaagcgcacctattgcggcgcgatcggggtcgaattcatgcatatttccgatccg
gctgaaaaggcctggattcaggaacgcatcgaaggcccggacaagaaggttgccttcacg
ccggagggcaagaaggccatcctgtccaagctcatcgaggcggaaggcttcgagcagttc
atcgatgtcaagtataagggcaccaagcgtttcggtcttgatggcggcgaatcgctgatc
cccgcgcttgagcagatcgtcaagcgcggcggccagatgggtctcaaggaagtcgtgctc
ggcatggcgcaccgtggccgcctcaacgtgctgagccaggtcatgggcaagccgcaccgc
gccattttccatgagttcaagggcggttcctatacgccggacgatgtggaaggttcgggc
gatgtgaagtaccatctgggcgcttcctccgaccgtgaattcgacggcaacaaggttcac
ctgtcgctgacggccaatccgtcgcatcttgaaatcgtcaatccggtggtgatgggcaag
gcccgcgccaagcaggacctgcttgtgggccgcacccgcgacgacatggtgccgctttcc
gaacgcgccaaggttctgccgctgctgctgcatggcgatgcggcctttgccggtcagggc
gtcgtggcggaatgcctcggcctttccggcctgaagggacaccgtgttgccggtacgctg
catttcatcatcaacaaccagatcggtttcaccaccaatccggccttctcgcgttcttcg
ccttatccgtccgatgtggcgaagatgatcgaagcgccgatcttccacgtcaatggcgac
gacccggaagcggtggtctttgcagccaaggtggcgaccgaattccgcatgaccttccac
aagccggtggtcatcgatatgttctgctatcgccgcttcggccacaatgaaggcgacgag
ccgtccttcacccagccgttgatgtacaaggcgattcgtgcgcacaagaccacggttcag
ctttatggcgagaagctgatcgccgaaggcctggtcacgcaggacgatatcgaccggatg
aaggccgactggcgccagaagctcgaaggcgagttcgaggccggccagagctacaagccg
aacaaggccgactggcttgacggtgcgtgggctggcctgcgcaccgcagacaatgcggat
gaacagcgccgcggcaagacggctgtgccggtgaagacgctcaaggaaatcggcaagaag
ctcgttgaagtgccgaaggatttccatgtccatcgcacgatccagcgtttcctcgacaac
cgtgccaagatgatggaaacgggtgaggggatcgactgggcgacggctgaatcgctggcg
ttcggttcactggccgttgaagctcatccgatccgcctgtcgggacaggacgtcgagcgc
ggtactttctcgcagcgccatacggttctttacgatcaggaaaaccagaaccgctacatc
ccgctgaacaatcttcagaagggacaggcgatctacgaagccatcaattcgatgctctcg
gaagaagccgtcctcggctacgaatacggctattcgctgtctgacccgcgcgcgcttgtt
ctgtgggaagcccagtttggtgacttcgccaatggtgcgcaggtcgtgtttgaccagttc
atctcgtcgggcgaacgcaagtggctgcgtatgtctggtctcgtctgccttctgccgcat
ggttttgaaggtcaggggccggaacactcctcggcgcgtctggaacgttatctccagctt
tgtgcggaagacaatatgcaggtggcaaacgtcacgacgcctgccaactacttccacatt
ctgcgtcgccagatgaagcgcgacttccgcaagccgctcatcatgatgacgccgaagtcg
ctgctgcgccacaagcgcgcaatctcgacgctggccgagctttcgggcgaatcctcgttc
caccgcctgctgtgggacgatgcgcagtacaacaaggatgaaggcatcaagctccagaag
gatgccaagatccgccgcgtcgtgctctgttcgggcaaggtctattacgacctttacgaa
gaacgcgagaagcgcggcatcgacgatgtctatctgctgcgtgtcgagcagctctatccg
ttcccggccaaggcgctcatcaacgagctgtcgcgcttccgtcatgcggaaatggtctgg
tgccaggaagagccgaagaacatgggcgcatggtcgttcatcgacccgtatctggagtgg
gtactggcgcatatcgacgccaagcaccagcgcgtgcgctatgcgggccgtccggccgcc
gcatcgcctgcaacgggcctgatgtcgaagcaccttgcgcagcttgccgctttccttgag
gatgcgcttggctga

DBGET integrated database retrieval system