KEGG   Halobacteriovorax marinus: BMS_0474Help
Entry
BMS_0474          CDS       T01659                                 

Definition
(GenBank) putative succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00020  Citrate cycle (TCA cycle)
bmx00190  Oxidative phosphorylation
bmx00650  Butanoate metabolism
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
Module
bmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_0474
   00650 Butanoate metabolism
    BMS_0474
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMS_0474
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMS_0474
    1.3.5.4  fumarate reductase (quinol)
     BMS_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox HI0933_like FAD_binding_3 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBW25387
UniProt: E1X4F7
LinkDB All DBs
Position
492860..494770
Genome map
AA seq 636 aa AA seqDB search
MKLDAKIPEGELEKKWSNYQDKCKLVNTANKKKFEVIVVGSGLSGAGAAATLAELGYKVN
CFCYQDTPRRAHSVAAQGGVNAAKNYQHDGDSVWRMFYDTLKGGDFRSREANVYRLAQLS
APLIDHFTQQGVPFAREYGGVLTNRSFGGVQVQRTFYARGQTGQQLLIAAYSQLSKMVAS
GGVKMNTREEMLDLVVIDGKARGIITRDLVTGEIKRHSAHAVVLATGGYSRVFRLSTLAI
GCNGSAIWAAHKKGAYFAGPSFTQIHPTALPQSSDTQSKLTLMSESLRNDGRIWVPLKKD
DSRKPGDIPEEERDYYLERRYPSFGNLCPRDIASRAAKERIDAGHGVGPLKNAVYLDFKH
AIAKQGEDKVKDKYGNLFNMYLKITGIDAYKEPMKISPAAHFSMGGLWVDYELMTTINGL
YAIGEANYSDHGANRLGANSLLQASIDGYFILPNTINNYLAGELNHDIPTVEHQEFLKAQ
EVVKEKIDKLMSINGTKTVDDFHRELGAVMWQECAMSRNQKGLEDAIVKIKNIKEEFWKE
VSISGSDKELNTELEKGLRLSDFIELAELMCVDALQRDESCGAHFREEFQSAEGEAVRND
EDYSYVSAWEYNNGDFKLHREELEFEFVKPTVRSYK
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagatgcaaaaattcccgagggagaacttgaaaagaaatggtccaactatcaa
gataaatgcaaacttgtaaatactgccaataaaaagaagttcgaggtcattgttgtgggg
tctggtttatctggcgccggagcagcggcaactctagcggagctcggatataaggtaaat
tgtttttgctatcaagatacaccaagaagggcgcactctgtagcagctcaaggtggtgtg
aacgcggctaagaattatcagcatgatggagatagtgtctggcgtatgttctatgacact
ctaaaaggtggagactttcgttctcgtgaggctaatgtttatcgtttggcacagctttca
gctccactaattgatcactttactcagcaaggtgttccttttgctagagagtacggagga
gttttaacgaatagaagttttggaggagtacaagttcaaagaactttctacgctagaggc
caaacaggtcaacaactcttaattgctgcctactctcagttatcaaaaatggtggcgagt
ggtggagtgaaaatgaatactcgagaagagatgcttgaccttgttgttatcgatggaaag
gcgagaggaattatcactcgagatttagttactggagaaattaagcgccatagtgctcat
gcagtagttctcgccacagggggatattctagagtctttaggctctcaactctagcgatt
gggtgcaacggctctgccatttgggccgctcataaaaaaggagcgtactttgctggacct
agctttactcaaatacatcccacagctcttccccagtccagtgatacacaatctaaattg
actctcatgtcagagtctcttcgaaatgatggccgaatttgggtacctttaaagaaagat
gactcgagaaagcctggagatattccagaagaagagcgagattattatcttgagagaagg
tatcctagttttggaaatctctgtccaagagacattgcttcaagggcggctaaagagaga
attgatgctggtcatggagtcggacctcttaaaaatgcagtctatttagattttaagcat
gcaattgccaaacagggtgaagataaagttaaagataagtacggaaacctctttaatatg
tatctaaaaatcacagggattgatgcttataaagagccaatgaagatttctcctgccgct
catttttctatgggagggctttgggttgattacgagcttatgacaactattaatggtctc
tatgctattggtgaggcgaattactcagatcatggggccaacagacttggagcgaactca
cttcttcaagcaagtattgatggttactttattcttcctaatacaattaataactacctc
gctggtgagttaaatcatgatattccgactgtagaacatcaagaatttttaaaagctcaa
gaggtggtgaaagaaaaaattgataaacttatgagcatcaatggaacaaaaacagttgat
gactttcatagagagcttggtgcagtcatgtggcaagagtgcgcaatgagtagaaatcaa
aaaggattggaagacgccattgttaaaataaaaaatattaaagaagagttttggaaagaa
gtaagtatttctggatcagataaagagttgaatactgagttagaaaaaggcctccggtta
tcagattttatagaactggcagaactaatgtgtgtagacgctcttcaaagagatgaatca
tgtggagcacactttagagaagaatttcaaagtgcagagggagaagctgttagaaatgat
gaagactatagctatgtttctgcatgggaatataataatggagattttaagcttcataga
gaagagttagaatttgaattcgttaaacctacagtaaggtcgtataaatga

DBGET integrated database retrieval system