KEGG   Halobacteriovorax marinus: BMS_0475Help
Entry
BMS_0475          CDS       T01659                                 

Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00020  Citrate cycle (TCA cycle)
bmx00190  Oxidative phosphorylation
bmx00650  Butanoate metabolism
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
Module
bmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_0475
   00650 Butanoate metabolism
    BMS_0475
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMS_0475
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMS_0475
    1.3.5.4  fumarate reductase (quinol)
     BMS_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_9 Fer4_21 Fer4_6 Fer4_4 Fer4_15 Fer4_10 Fer4 Fer2 Fer4_2 Fer4_16 Fer4_22 AvrPtoB-E3_ubiq
Motif
Other DBs
NCBI-ProteinID: CBW25388
UniProt: E1X4F8
LinkDB All DBs
Position
494767..495513
Genome map
AA seq 248 aa AA seqDB search
MKVKFKIWRQSNKDSKGGFVLYEVDNISEEMSFLEALDALNEKLARKGDSVVAFDHDCRE
GICGQCGVFINGRAHGPHSNTTTCQLHMRSFKDGETIVVEPWRAKAFPIIKDLVVDRSSF
DRIIQSGGFITAKTGTAAEANSILIGKEVADAAMDVAACIGCGACVATCKNSAAALFTSA
KISHLNSLPQGKPEANERTLKMAEQMELEDFGHCSFTGSCEVECPENISISNIAKMNFDL
LKAKILKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaatttaagatatggagacagagcaataaagactctaaaggtggctttgtt
ttatatgaagttgataatatttcagaagagatgtctttcttagaggcattagatgcgctt
aatgagaaacttgctagaaagggagactctgtcgttgcatttgatcacgactgtagagag
ggaatttgtgggcaatgtggcgttttcattaatggtagagcacacggacctcattctaat
acaacgacctgtcaattacatatgagaagttttaaagatggtgaaacaattgtcgtagag
ccttggagagcaaaagcgtttccaattataaaagatcttgttgtagatagaagctcattt
gatcgcattattcaaagtggtggatttattacagctaaaactggtacagctgctgaggcc
aattcaattctaataggaaaagaagttgcagatgcagcaatggatgttgctgcatgtatt
gggtgtggtgcatgtgttgcgacttgtaagaactctgctgctgcactctttacgtcagct
aagattagtcatctaaattcattgccacaaggtaagcctgaggcaaatgagagaactctt
aaaatggcggaacaaatggagttagaagattttgggcattgctcatttacgggttcttgt
gaagttgaatgccctgagaatatctcaatttcaaatattgcaaagatgaattttgattta
cttaaagctaagattttgaagaaatag

DBGET integrated database retrieval system