KEGG   Halobacteriovorax marinus: BMS_0580Help
Entry
BMS_0580          CDS       T01659                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristol-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00061  Fatty acid biosynthesis
bmx00780  Biotin metabolism
bmx01100  Metabolic pathways
bmx01212  Fatty acid metabolism
Module
bmx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMS_0580 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMS_0580 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmx01004]
    BMS_0580 (fabZ)
Enzymes [BR:bmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BMS_0580 (fabZ)
Lipid biosynthesis proteins [BR:bmx01004]
 Fatty acid synthase
  Component type
   BMS_0580 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: CBW25489
UniProt: E1X518
LinkDB All DBs
Position
603446..603931
Genome map
AA seq 161 aa AA seqDB search
MKVSNEFVLQFLPHRDPFLFIDSVKDVIPARELTEGEILPLKELVGSKVQANFHMREDHP
IFAGHFPGNPIFPGVAQVEMMAQASSFIYVNAFENPYGQNMDVALVSISNAKFRKPVLPG
MDLEIETECTKIRGPMVESHCKLFCDGQLMSECTVMASVKM
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtttcaaatgagttcgttttacaatttttaccacatagggatccattcctattc
attgattctgttaaggatgtaatacctgccagagagctgacagagggagaaattcttccg
cttaaggaattagtaggttcaaaggttcaagcaaatttccacatgagagaagatcatcca
atttttgctgggcactttccaggaaaccctatttttccaggtgttgctcaagtagagatg
atggcccaggcttctagctttatttatgtaaatgcatttgaaaatccatacggtcaaaat
atggacgtagcattggtatcaattagtaatgcaaaatttagaaagccagttcttccagga
atggatttagagattgagacagagtgtacaaagatacgtggacctatggtggagagtcat
tgcaagttattctgtgatgggcaactaatgtctgagtgtacagttatggcctcagtaaag
atgtag

DBGET integrated database retrieval system