KEGG   Halobacteriovorax marinus: BMS_1520Help
Entry
BMS_1520          CDS       T01659                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmx  Halobacteriovorax marinus
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMS_1520 (ahpF)
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BMS_1520 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox FAD_binding_2 HI0933_like Thioredoxin_3 Thi4 FAD_oxidored DAO FAD_binding_3 NAD_binding_8 K_oxygenase NAD_binding_7 Lycopene_cycl DSBA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBW26376
UniProt: E1X0N8
LinkDB All DBs
Position
1500197..1501741
Genome map
AA seq 514 aa AA seqDB search
MLDSQILDQLKGVYQNLENQIELVYNNSEHAKQAELVEMLNSLAQTSDKISVSASSESAN
APSFSIKYNGEFNGVSFVGIPGGHEFTSLVLAILNSDLKGKLPDEGIIRRIKSIKGDVKL
RTYISLSCENCPEVVQSLNLISILNSNISHEMVDGEFEQEEIERLKIQGVPSVMVGDELF
SSGKTNLAALLTKLEEKFGSVDLSDEDRELGTFDVVVVGAGPAGASAAIYSARKGLKTVV
IAEKVGGQVSDTKGIENLISVPYTEGPELSSKLLGHMNEYDISILEHRLVKKVENSSLKE
LTLSSGETLKTKSLIIATGAKWRELGIEGEKEYTGRGVAYCPHCDGPYYKGKDVAVIGGG
NSGVEAAIDLAGIVKSVTLYEFLTELKADEVLVKKLESLDNVNIIKNARTSKVIGDGDKV
VALEYENREDGSLHEQKLDGVFVQIGLSPNSSFIKDVVNTNKFGEIEIDTKCRTNIAGIY
AAGDVTTVPYKQIIISMGEGAKAALAAFEDNMTS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttggattcacagatattagatcagctaaaaggcgtctatcaaaatttagaaaatcag
attgagctcgtttataacaatagcgaacatgctaaacaggcagagcttgttgagatgcta
aactctctagcgcagacctctgataaaatatctgtaagtgcaagtagtgagagcgcaaat
gctccatcattctctataaagtataacggagagtttaatggtgtttcatttgtaggtatt
ccaggtggacatgaatttacttcacttgttttagctattttaaattcagatttaaaaggt
aagcttccagatgaaggaatcattcgaagaattaagagtattaagggtgatgtgaagctt
agaacttatatttctctctcttgtgagaattgccccgaagtggttcaatcgctcaatctt
atttcaattttaaattcaaatatttctcatgaaatggttgatggtgaatttgaacaagaa
gagattgaaagacttaagattcagggggttcctagtgttatggtaggggacgagctcttt
agttctggtaagacaaaccttgcggcccttttaacaaaattagaagagaaatttggttca
gttgatttaagcgatgaagatagagagcttggaacttttgatgttgtagtcgttggagca
gggcctgcgggtgcttcggccgccatttactctgcccgtaaaggtcttaagacagttgtc
attgcagagaaagttggaggacaggtaagtgatactaaaggtatcgaaaacctaatctct
gtgccatatacagaaggcccagagttatcttctaaactccttggacacatgaatgaatac
gatataagcattcttgaacatagacttgtcaaaaaagttgaaaactctagcttaaaagag
ctgactttaagtagtggcgaaacgttaaagacaaaatctctcattattgcaactggtgct
aagtggagagaacttgggattgagggtgaaaaagaatataccggtagaggagtggcctat
tgtcctcactgtgatggcccatactataaaggaaaggatgttgccgtaattggaggagga
aactctggagtggaagcggcgattgatctcgcaggtatagttaagtctgtaacgctctat
gaatttcttactgagctaaaggccgacgaggttctagtgaagaaattggagtcactagac
aatgtaaatataataaagaatgcgagaacatcaaaggtcattggtgacggagataaagtt
gttgctcttgagtatgagaaccgtgaagatggaagtttacacgagcaaaagcttgatggt
gtctttgttcagattgggttgagtccaaatagttcattcataaaagatgttgtgaataca
aataagtttggtgaaattgaaatcgatacaaagtgtagaacaaatattgctggaatctat
gctgccggcgatgtgacaacagttccttataagcagataatcatttcaatgggcgaaggg
gcgaaggcagctctggccgcctttgaagataatatgacttcttaa

DBGET integrated database retrieval system