KEGG   Halobacteriovorax marinus: BMS_2346Help
Entry
BMS_2346          CDS       T01659                                 

Definition
(GenBank) putative D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00473  D-Alanine metabolism
bmx00550  Peptidoglycan biosynthesis
bmx01100  Metabolic pathways
bmx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMS_2346
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMS_2346
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMS_2346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmx01011]
    BMS_2346
Enzymes [BR:bmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMS_2346
Peptidoglycan biosynthesis and degradation proteins [BR:bmx01011]
 Precursor biosynthesis
  Amino acid ligase
   BMS_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 RimK CPSase_L_D2 GARS_A ATPgrasp_ST Ilar_coat ATPgrasp_Ter Ins134_P3_kin
Motif
Other DBs
NCBI-ProteinID: CBW27144
UniProt: E1X4R8
LinkDB All DBs
Position
2358086..2359096
Genome map
AA seq 336 aa AA seqDB search
MKVLVLMHKDLVPPTDIKEDQFDKDEVPWITEYDVIKALNNLGHKVEICGVISDLKLIKN
AIDKFKPTVIFNLLEEFDGEVLFDQNVVSYLELLRVPYTGCNPRGLMLARDKALAKKILL
FHRIKTPHFQVFPKNRKVKTSKHLKYPLIVKCLTEEASLAIAKASIVYNEEKLKERVKYI
NQKIGVDAIVEEFIEGREFYVGVMGNYKTQTLPVWELKFENVEKPEKELYSNRAKWNNKY
RDRKGIKTEAATLSPELELKIKNICKKVYKHLNLNGYARVDLRMNPAGEVYVIEVNPNPN
IAREDELASSALHSKVNYEQLITKILKLAKSWAKKV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtactcgtattaatgcataaagacctcgttcctcctacggatattaaagaagat
caattcgataaagatgaagtgccatggataacagaatatgatgttattaaggcgctcaat
aatttgggacacaaagttgaaatctgtggtgtcataagtgatctaaaacttataaaaaat
gctattgataaatttaagccaacagttatctttaacttacttgaagaatttgatggtgaa
gttctctttgatcaaaatgttgtgagttacctagagcttttacgtgttccttatacgggc
tgtaacccaagaggtcttatgcttgcaagagacaaggccttggcgaagaaaattcttctc
tttcaccgaatcaaaactccacactttcaagtctttcctaagaatagaaaagttaaaact
tcaaagcatctaaaataccctcttattgtgaagtgcctcacagaggaagcttcattagca
atagccaaggcatcaattgtttacaatgaagagaagctcaaagagagagtaaagtatatc
aatcaaaaaattggtgtcgatgccatcgttgaagaattcattgaaggtagagaattctat
gtgggagttatgggaaattataaaactcaaactcttcccgtatgggagttgaaatttgaa
aatgttgaaaagcctgagaaagaactctactccaatagggccaagtggaataataaatat
cgagaccgaaagggaattaaaactgaagcagcaaccctatcccctgaattagaacttaaa
attaaaaatatttgtaagaaagtatacaagcatctaaatcttaatggatacgctagagtt
gatcttagaatgaatccagcaggagaagtctacgtcatagaggttaatcccaatcctaat
attgcacgtgaagatgaacttgccagtagcgcattacactccaaagtaaattatgaacaa
ttaattacgaagattttaaaacttgctaaatcatgggctaagaaagtctaa

DBGET integrated database retrieval system